SitesBLAST
Comparing H281DRAFT_02753 FitnessBrowser__Burk376:H281DRAFT_02753 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
48% identity, 76% coverage: 91:427/444 of query aligns to 3:336/336 of 5a06A
- active site: K101 (= K189), Y186 (= Y274)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L11 (= L99), G12 (= G100), Y13 (≠ R101), Y14 (≠ L102), S36 (= S124), G37 (= G125), T38 (≠ D126), K41 (= K129), Y59 (= Y147), I77 (≠ V165), T78 (≠ L166), P79 (= P167), N80 (= N168), L82 (≠ M170), H83 (= H171), E100 (= E188), K101 (= K189), R129 (= R217), W168 (= W256), R169 (= R257), Y186 (= Y274), Y264 (= Y353)
- binding sorbitol: D72 (≠ Q160), H96 (= H184), K101 (= K189), R122 (= R210), R122 (= R210), L124 (= L212), F160 (≠ Q248), R169 (= R257), D182 (= D270), Y186 (= Y274), K287 (≠ Q378), H296 (= H387), E299 (≠ V390), E306 (≠ Q397), G310 (≠ P401), G311 (= G402)
Sites not aligning to the query:
5a03C Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
48% identity, 76% coverage: 91:427/444 of query aligns to 3:336/336 of 5a03C
- active site: K101 (= K189), Y186 (= Y274)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G10 (= G98), L11 (= L99), G12 (= G100), Y13 (≠ R101), Y14 (≠ L102), S36 (= S124), G37 (= G125), T38 (≠ D126), K41 (= K129), Y59 (= Y147), I77 (≠ V165), T78 (≠ L166), P79 (= P167), N80 (= N168), L82 (≠ M170), H83 (= H171), E100 (= E188), K101 (= K189), R129 (= R217), W168 (= W256), R169 (= R257), Y186 (= Y274), Y264 (= Y353)
- binding beta-D-xylopyranose: K101 (= K189), F160 (≠ Q248), R169 (= R257), D182 (= D270), Y186 (= Y274)
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
48% identity, 76% coverage: 91:427/444 of query aligns to 2:335/335 of 5a05A
- active site: K100 (= K189), Y185 (= Y274)
- binding beta-D-glucopyranose: K100 (= K189), F159 (≠ Q248), D181 (= D270), Y185 (= Y274)
- binding alpha-D-glucopyranose: P259 (= P349), S262 (≠ G352)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G98), L10 (= L99), G11 (= G100), Y12 (≠ R101), Y13 (≠ L102), S35 (= S124), G36 (= G125), T37 (≠ D126), K40 (= K129), Y58 (= Y147), I76 (≠ V165), T77 (≠ L166), P78 (= P167), N79 (= N168), L81 (≠ M170), H82 (= H171), E99 (= E188), K100 (= K189), R128 (= R217), W167 (= W256), R168 (= R257), Y185 (= Y274), Y263 (= Y353)
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
48% identity, 76% coverage: 91:427/444 of query aligns to 2:335/335 of 5a04A
- active site: K100 (= K189), Y185 (= Y274)
- binding beta-D-glucopyranose: K100 (= K189), F159 (≠ Q248), R168 (= R257), D181 (= D270), Y185 (= Y274)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L10 (= L99), G11 (= G100), Y12 (≠ R101), Y13 (≠ L102), S35 (= S124), G36 (= G125), T37 (≠ D126), K40 (= K129), Y58 (= Y147), I76 (≠ V165), T77 (≠ L166), P78 (= P167), N79 (= N168), L81 (≠ M170), H82 (= H171), E99 (= E188), K100 (= K189), R128 (= R217), W167 (= W256), R168 (= R257), Y185 (= Y274), Y263 (= Y353)
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
48% identity, 76% coverage: 91:427/444 of query aligns to 2:335/335 of 5a03E
- active site: K100 (= K189), Y185 (= Y274)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G98), L10 (= L99), G11 (= G100), Y12 (≠ R101), Y13 (≠ L102), S35 (= S124), G36 (= G125), T37 (≠ D126), K40 (= K129), Y58 (= Y147), I76 (≠ V165), T77 (≠ L166), P78 (= P167), N79 (= N168), H82 (= H171), E99 (= E188), K100 (= K189), R128 (= R217), W167 (= W256), R168 (= R257), Y185 (= Y274), Y263 (= Y353)
- binding beta-D-xylopyranose: K100 (= K189), F159 (≠ Q248), R168 (= R257), D181 (= D270), Y185 (= Y274), E205 (≠ V294), T207 (≠ R296), R209 (≠ E298)
- binding alpha-D-xylopyranose: H134 (≠ M223), M268 (≠ L358), R279 (≠ T371), E280 (= E372)
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
48% identity, 76% coverage: 91:427/444 of query aligns to 2:335/335 of 5a02A
- active site: K100 (= K189), Y185 (= Y274)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L10 (= L99), G11 (= G100), Y12 (≠ R101), Y13 (≠ L102), S35 (= S124), G36 (= G125), T37 (≠ D126), K40 (= K129), Y58 (= Y147), I76 (≠ V165), T77 (≠ L166), P78 (= P167), L81 (≠ M170), H82 (= H171), E99 (= E188), K100 (= K189), R128 (= R217), W167 (= W256), R168 (= R257), Y185 (= Y274), Y263 (= Y353)
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
47% identity, 77% coverage: 86:426/444 of query aligns to 28:372/383 of 1h6dA
- active site: K131 (= K189), Y219 (= Y274)
- binding glycerol: K131 (= K189), R202 (= R257), D215 (= D270), Y219 (= Y274)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G40 (= G98), L41 (= L99), G42 (= G100), K43 (≠ R101), Y44 (≠ L102), S66 (= S124), G67 (= G125), K71 (= K129), Y89 (= Y147), I107 (≠ V165), L108 (= L166), P109 (= P167), N110 (= N168), H113 (= H171), E130 (= E188), K131 (= K189), R159 (= R217), A198 (≠ G254), W201 (= W256), R202 (= R257), Y219 (= Y274), Y298 (= Y353)
Sites not aligning to the query:
1rydA Crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis
47% identity, 77% coverage: 86:426/444 of query aligns to 26:370/381 of 1rydA
- active site: K129 (= K189), Y217 (= Y274)
- binding alpha-D-glucopyranose: Y236 (≠ S293), I254 (≠ H311), Q256 (≠ I313)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L39 (= L99), G40 (= G100), K41 (≠ R101), Y42 (≠ L102), S64 (= S124), G65 (= G125), K69 (= K129), Y87 (= Y147), L106 (= L166), P107 (= P167), N108 (= N168), L110 (≠ M170), H111 (= H171), E128 (= E188), K129 (= K189), R157 (= R217), A196 (≠ G254), W199 (= W256), R200 (= R257), Y217 (= Y274), Y296 (= Y353)
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
47% identity, 75% coverage: 91:425/444 of query aligns to 2:328/340 of 1evjA
- active site: K100 (= K189), Y188 (= Y274)
- binding nicotinamide-adenine-dinucleotide: G9 (= G98), L10 (= L99), G11 (= G100), K12 (≠ R101), Y13 (≠ L102), D35 (≠ S124), L77 (= L166), P78 (= P167), N79 (= N168), H82 (= H171), E99 (= E188), K100 (= K189), R128 (= R217), W170 (= W256), R171 (= R257), Y188 (= Y274), Y267 (= Y353)
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
26% identity, 75% coverage: 94:427/444 of query aligns to 3:328/332 of 2glxA
- active site: K93 (= K189), H179 (≠ Y274)
- binding acetate ion: K93 (= K189), H179 (≠ Y274)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G98), A8 (≠ L99), S9 (≠ G100), T10 (≠ R101), I11 (≠ L102), S32 (= S124), T33 (≠ G125), R37 (≠ K129), S69 (≠ V165), T70 (≠ L166), N72 (= N168), H75 (= H171), E92 (= E188), K93 (= K189), H121 (≠ R217), W161 (= W256), R162 (= R257), Y282 (≠ F381)
6a3iA Levoglucosan dehydrogenase, complex with nadh and levoglucosan (see paper)
29% identity, 48% coverage: 130:343/444 of query aligns to 48:268/372 of 6a3iA
- binding Levoglucosan: K103 (= K189), Y132 (≠ S218), Y160 (vs. gap), Q162 (≠ A244), R175 (= R257), D188 (= D270), H192 (≠ Y274)
- binding 1,4-dihydronicotinamide adenine dinucleotide: P81 (= P167), N82 (= N168), L84 (≠ M170), H85 (= H171), E102 (= E188), K103 (= K189), W174 (= W256), R175 (= R257)
Sites not aligning to the query:
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
26% identity, 75% coverage: 94:427/444 of query aligns to 4:329/333 of Q2I8V6
- ASTI 9:12 (≠ LGRL 99:102) binding
- S10 (≠ G100) mutation to G: Almost no effect.
- A13 (≠ S103) mutation to G: Can use NAD as cosubstrate as well as NADP.
- S33 (= S124) mutation to D: No activity.
- ST 33:34 (≠ SG 124:125) binding
- R38 (≠ K129) binding
- TTNELH 71:76 (≠ LPNGMH 166:171) binding
- EK 93:94 (= EK 188:189) binding
- K94 (= K189) mutation to G: Less than 1% remaining activity.
- N120 (≠ A215) binding
- WR 162:163 (= WR 256:257) binding
- D176 (= D270) mutation to A: Less than 1% remaining activity.
- H180 (≠ Y274) mutation to A: Less than 2% remaining activity.
- G206 (≠ D300) mutation to I: No effect.
- Y283 (≠ F381) binding
B3TMR8 dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase; 3-ketoreductase; NADPH-dependent C3-ketoreductase; EC 1.1.1.384 from Actinomadura kijaniata (see paper)
27% identity, 74% coverage: 91:420/444 of query aligns to 11:327/332 of B3TMR8
- 17:23 (vs. 99:105, 0% identical) binding
- SR 42:43 (≠ SG 124:125) binding
- Y63 (≠ F150) binding
- L79 (= L166) binding
- H84 (= H171) binding
- K102 (= K189) active site, Proton donor; mutation K->A,M,Q: Loss of reductase activity.; mutation to E: Retains some activity, but the catalytic efficiency is strongly reduced.
- R170 (= R257) binding
- D182 (= D270) binding
- Y186 (= Y274) mutation to F: Same affinity for dTDP-glucose and NADPH compared to the wild-type. Small reduction of the catalytic efficiency resulting from the conformational flexibility of the nicotinamide ring.
3rc1A Crystal structure of kijd10, a 3-ketoreductase from actinomadura kijaniata incomplex with NADP and tdp-benzene (see paper)
27% identity, 74% coverage: 91:420/444 of query aligns to 4:320/325 of 3rc1A
- active site: K95 (= K189), Y179 (= Y274)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C10 (≠ L99), A11 (≠ G100), D12 (≠ R101), I13 (≠ L102), S35 (= S124), R36 (≠ G125), Y56 (≠ F150), P71 (≠ V165), L72 (= L166), P73 (= P167), H77 (= H171), E94 (= E188), K95 (= K189), I162 (≠ W256), R163 (= R257), V168 (≠ L262), D175 (= D270), Y179 (= Y274)
- binding phosphate ion: H278 (≠ Q378), K283 (≠ R383)
- binding 5'-O-[(S)-hydroxy{[(S)-hydroxy(phenoxy)phosphoryl]oxy}phosphoryl]thymidine: R16 (≠ D105), R17 (≠ Q106), F152 (≠ N246), I154 (≠ Q248), P155 (≠ N249), Y233 (≠ E332), T253 (vs. gap)
6a3jC Levoglucosan dehydrogenase, complex with nadh and l-sorbose (see paper)
29% identity, 48% coverage: 130:343/444 of query aligns to 47:272/378 of 6a3jC
- binding 1,4-dihydronicotinamide adenine dinucleotide: T79 (≠ L166), P80 (= P167), N81 (= N168), H84 (= H171), E101 (= E188), K102 (= K189), W173 (= W256), R174 (= R257)
- binding alpha-L-sorbopyranose: K102 (= K189), Y131 (≠ S218), Y159 (vs. gap), Q161 (≠ A244), W163 (≠ N246), R174 (= R257), D187 (= D270)
Sites not aligning to the query:
7xr9A Crystal structure of dgpa with glucose (see paper)
28% identity, 61% coverage: 149:421/444 of query aligns to 51:339/344 of 7xr9A
- binding beta-D-glucopyranose: K91 (= K189), R150 (≠ Q248), W157 (= W256), F160 (vs. gap), D173 (= D270), H177 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: D51 (≠ N149), Y52 (≠ F150), C67 (≠ V165), T68 (≠ L166), P69 (= P167), H73 (= H171), E90 (= E188), K91 (= K189), P92 (= P190), Q119 (≠ R217), V159 (vs. gap), F160 (vs. gap), Q166 (≠ A263)
Sites not aligning to the query:
F0M433 Levoglucosan dehydrogenase; LGDH; 1,6-anhydro-beta-D-glucose dehydrogenase; PpLGDH; EC 1.1.1.425 from Pseudarthrobacter phenanthrenivorans (strain DSM 18606 / JCM 16027 / LMG 23796 / Sphe3) (Arthrobacter phenanthrenivorans) (see paper)
27% identity, 48% coverage: 130:343/444 of query aligns to 49:284/390 of F0M433
- T81 (≠ L166) binding
- N83 (= N168) binding
- H86 (= H171) binding
- E103 (= E188) binding
- K104 (= K189) binding ; binding
- A130 (= A215) binding
- N132 (≠ R217) binding
- Y133 (≠ S218) binding
- Q163 (≠ A244) binding
- W175 (= W256) binding
- R176 (= R257) binding ; binding
- D189 (= D270) binding
- H193 (≠ Y274) binding
Sites not aligning to the query:
- 13 binding
- 14 binding
- 43 binding
- 335 binding
7xreC Crystal structure of dgpa
28% identity, 61% coverage: 149:421/444 of query aligns to 61:358/363 of 7xreC
- binding nicotinamide-adenine-dinucleotide: T78 (≠ L166), P79 (= P167), N80 (= N168), H83 (= H171), E100 (= E188), K101 (= K189), P102 (= P190), F170 (≠ R257), Q176 (≠ A263), H187 (vs. gap), Y313 (≠ Q380), F314 (= F381)
Sites not aligning to the query:
3e18A Crystal structure of NAD-binding protein from listeria innocua
26% identity, 63% coverage: 147:425/444 of query aligns to 52:346/348 of 3e18A
- active site: K94 (= K189), H178 (≠ Y274)
- binding nicotinamide-adenine-dinucleotide: A70 (≠ V165), T71 (≠ L166), P72 (= P167), N73 (= N168), H76 (= H171), E93 (= E188), K94 (= K189), N122 (≠ R217), W161 (= W256), R162 (= R257), H178 (≠ Y274)
Sites not aligning to the query:
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
25% identity, 75% coverage: 94:427/444 of query aligns to 4:329/333 of 4koaA
- active site: K94 (= K189), H180 (≠ Y274)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G98), A9 (≠ L99), S10 (≠ G100), T11 (≠ R101), I12 (≠ L102), S33 (= S124), S34 (≠ G125), R38 (≠ K129), T71 (≠ L166), N73 (= N168), H76 (= H171), K94 (= K189), Q160 (vs. gap)
Query Sequence
>H281DRAFT_02753 FitnessBrowser__Burk376:H281DRAFT_02753
MPTRNRTSHSDQPTSDVPTEATAPAETARRLFLRRGGASLAAALTVGSASSVLAAGPNGA
DTNQVKLPLIQDPDTEQKEETPDANLPPDERVGYAIVGLGRLSLDQILPALAQCKYSKVV
ALVSGDRAKALRVARQYGVREADIYDYQNFERLADNPRVQVVYIVLPNGMHKEFTLRSAN
IGKHVLCEKPMANSAADCEAMVRAMKRANRKLMIAYRSQYEPMDRMIAKMVKEKQLGPLR
EFVAGNSQNVGDPGQWRLKKSLAGGGAMPDIGLYCLNAARFLSGEEPLEVVASVHRPEND
PRFVEVEESVHFILRFPSGFTATCMSSYASHESRFFRLQGSKGWVEMDPAFGYNGLRLRH
GMLVEGKSATTELQIDPQNQFAREIDHMSVCVKDDIQPHTPGEEGLQDQRIIDAIYESAR
TGRAVKLAQASAPTRGPEPQQETF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory