SitesBLAST
Comparing H281DRAFT_02777 FitnessBrowser__Burk376:H281DRAFT_02777 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wy2A Crystal structure of alpha-glucosidase in complex with glucose (see paper)
43% identity, 98% coverage: 4:515/524 of query aligns to 2:530/535 of 3wy2A
- active site: D97 (= D99), R197 (= R199), D199 (= D201), E268 (= E264), H329 (= H325), D330 (= D326)
- binding beta-D-glucopyranose: D59 (= D61), Y62 (= Y64), H102 (= H104), R197 (= R199), D199 (= D201), E268 (= E264), H329 (= H325), D330 (= D326), R397 (= R388)
- binding glycerol: S101 (≠ N103), D169 (= D171), V170 (≠ L172), P175 (= P177), R178 (= R180), Q179 (≠ R181), F203 (≠ L205), Y204 (≠ L206), H206 (≠ K208), D240 (≠ T236), P244 (= P240), E280 (≠ Y275)
- binding magnesium ion: D20 (= D22), R22 (≠ N24), V26 (≠ I28), D28 (= D30)
3wy1A Crystal structure of alpha-glucosidase (see paper)
43% identity, 98% coverage: 4:515/524 of query aligns to 2:530/535 of 3wy1A
- active site: D97 (= D99), R197 (= R199), D199 (= D201), E268 (= E264), H329 (= H325), D330 (= D326)
- binding glycerol: S101 (≠ N103), D169 (= D171), V170 (≠ L172), F203 (≠ L205), Y204 (≠ L206), H206 (≠ K208)
- binding magnesium ion: D20 (= D22), D24 (= D26), V26 (≠ I28), D28 (= D30)
- binding (3R,5R,7R)-octane-1,3,5,7-tetracarboxylic acid: D59 (= D61), Y62 (= Y64), H102 (= H104), F144 (≠ M146), F163 (= F165), R197 (= R199), D199 (= D201), T200 (≠ V202), G225 (= G224), E268 (= E264), F294 (= F289), H329 (= H325), D330 (= D326), R397 (= R388)
3wy4A Crystal structure of alpha-glucosidase mutant e271q in complex with maltose (see paper)
43% identity, 98% coverage: 4:515/524 of query aligns to 2:530/535 of 3wy4A
- active site: D97 (= D99), R197 (= R199), D199 (= D201), Q268 (≠ E264), H329 (= H325), D330 (= D326)
- binding alpha-D-glucopyranose: D59 (= D61), Y62 (= Y64), H102 (= H104), I143 (≠ R145), F163 (= F165), D199 (= D201), T200 (≠ V202), G225 (= G224), Q268 (≠ E264), Q268 (≠ E264), F294 (= F289), H329 (= H325), D330 (= D326), R397 (= R388), R397 (= R388)
- binding glycerol: S101 (≠ N103), D169 (= D171), V170 (≠ L172), F203 (≠ L205), Y204 (≠ L206), H206 (≠ K208), L224 (vs. gap), G225 (= G224), A226 (≠ Q225), P227 (= P226), F294 (= F289), D330 (= D326), E374 (≠ D365), K395 (≠ Q386), G396 (= G387), G399 (≠ P390)
- binding magnesium ion: D20 (= D22), D24 (= D26), V26 (≠ I28), D28 (= D30)
6k5pC Structure of mosquito-larvicidal binary toxin receptor, cqm1 (see paper)
41% identity, 99% coverage: 6:524/524 of query aligns to 4:517/531 of 6k5pC
- active site: D97 (= D99), R196 (= R199), D198 (= D201), E264 (= E264), H331 (= H325), D332 (= D326)
- binding calcium ion: N101 (= N103), D168 (= D171), H202 (≠ L205), M203 (≠ L206), E205 (≠ K208)
- binding cobalt (ii) ion: H429 (≠ S433), H433 (≠ R437)
6k5pB Structure of mosquito-larvicidal binary toxin receptor, cqm1 (see paper)
41% identity, 99% coverage: 6:524/524 of query aligns to 4:517/531 of 6k5pB
- active site: D97 (= D99), R196 (= R199), D198 (= D201), E264 (= E264), H331 (= H325), D332 (= D326)
- binding calcium ion: N101 (= N103), D168 (= D171), H202 (≠ L205), M203 (≠ L206), E205 (≠ K208)
- binding magnesium ion: H7 (≠ R9), A8 (≠ G10)
6k5pA Structure of mosquito-larvicidal binary toxin receptor, cqm1 (see paper)
41% identity, 99% coverage: 6:524/524 of query aligns to 4:517/531 of 6k5pA
O06994 Oligo-1,6-glucosidase 1; Dextrin 6-alpha-D-glucanohydrolase; Oligosaccharide alpha-1,6-glucosidase 1; Sucrase-isomaltase 1; Isomaltase 1; EC 3.2.1.10 from Bacillus subtilis (strain 168) (see paper)
37% identity, 93% coverage: 1:488/524 of query aligns to 1:521/561 of O06994
- D20 (= D22) binding
- N22 (= N24) binding
- D24 (= D26) binding
- F26 (≠ I28) binding
- D28 (= D30) binding
7lv6B The structure of mall mutant enzyme s536r from bacillus subtilis
36% identity, 92% coverage: 6:488/524 of query aligns to 2:519/559 of 7lv6B
4mazA The structure of mall mutant enzyme v200s from bacillus subtilus (see paper)
36% identity, 92% coverage: 6:488/524 of query aligns to 2:519/559 of 4mazA
4m56A The structure of wild-type mall from bacillus subtilis (see paper)
36% identity, 92% coverage: 6:488/524 of query aligns to 2:516/555 of 4m56A
- active site: D95 (= D99), R195 (= R199), D197 (= D201), E250 (= E264), H326 (= H325), D327 (= D326)
- binding D-glucose: D57 (= D61), Y60 (= Y64), H100 (= H104), F142 (≠ M146), D197 (= D201), E250 (= E264), D327 (= D326), R413 (= R388)
5wczA Crystal structure of wild-type mall from bacillus subtilis with ts analogue 1-deoxynojirimycin (see paper)
36% identity, 92% coverage: 6:488/524 of query aligns to 2:516/556 of 5wczA
- active site: D95 (= D99), R195 (= R199), D197 (= D201), E250 (= E264), H326 (= H325), D327 (= D326)
- binding 1-deoxynojirimycin: D57 (= D61), Y60 (= Y64), H100 (= H104), F161 (= F165), D197 (= D201), V198 (= V202), E250 (= E264), H326 (= H325), D327 (= D326), R413 (= R388)
2ze0A Alpha-glucosidase gsj (see paper)
40% identity, 91% coverage: 5:480/524 of query aligns to 3:482/531 of 2ze0A
Q07837 Amino acid transporter heavy chain SLC3A1; D2h; Neutral and basic amino acid transport protein; NBAT; Solute carrier family 3 member 1; b(0,+)-type amino acid transporter-related heavy chain; rBAT from Homo sapiens (Human) (see 16 papers)
37% identity, 99% coverage: 4:521/524 of query aligns to 115:647/685 of Q07837
- V183 (≠ I72) to A: in CSNU; uncertain significance; impairs protein stability and dimer formation; dbSNP:rs1233216697
- N214 (= N103) binding
- T216 (≠ S105) to M: in CSNU; impairs protein stability and dimer formation; dbSNP:rs369641941
- C242 (≠ P132) modified: Disulfide link with 273
- E268 (= E155) to K: in CSNU; reduction in amino acid transport activity; dbSNP:rs757239030
- C273 (≠ Y160) modified: Disulfide link with 242
- D284 (= D171) binding
- F318 (≠ L205) binding
- L319 (= L206) binding
- E321 (≠ K208) binding
- T341 (≠ E227) to A: in CSNU; reduction in amino acid transport activity; dbSNP:rs200287661
- L346 (= L232) to P: in CSNU; uncertain significance
- I445 (≠ L322) to T: in CSNU; uncertain significance; dbSNP:rs187962930
- M467 (≠ V344) to T: in CSNU; impairs protein stability and dimer formation; loss of 80% of amino acid transport activity; dbSNP:rs121912691
- C571 (≠ E454) modified: Disulfide link with 666
- M618 (≠ G492) to I: in dbSNP:rs698761
Sites not aligning to the query:
- 114 modified: Interchain (with C-144 in SLC7A5)
- 666 modified: Disulfide link with 571
- 673 modified: Disulfide link with 685; C → R: in CSNU; uncertain significance; dbSNP:rs756823144
- 685 modified: Disulfide link with 673
6li9A Heteromeric amino acid transporter b0,+at-rbat complex bound with arginine (see paper)
37% identity, 99% coverage: 4:521/524 of query aligns to 53:585/623 of 6li9A
2pwgA Crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor castanospermine (see paper)
37% identity, 94% coverage: 6:499/524 of query aligns to 5:527/556 of 2pwgA
- active site: D98 (= D99), R197 (= R199), D199 (= D201), E253 (= E264), H325 (= H325), D326 (= D326)
- binding calcium ion: D21 (= D22), N23 (= N24), D25 (= D26), I27 (= I28), D29 (= D30)
- binding castanospermine: D60 (= D61), Y63 (= Y64), H103 (= H104), F163 (= F165), D199 (= D201), E253 (= E264), D326 (= D326), R413 (= R388)
4h8vA Crystal structure of the trehalulose synthase mutb in complex with trehalulose
37% identity, 94% coverage: 6:499/524 of query aligns to 6:528/557 of 4h8vA
- active site: D99 (= D99), R198 (= R199), D200 (= D201), E254 (= E264), H326 (= H325), D327 (= D326)
- binding calcium ion: D22 (= D22), N24 (= N24), D26 (= D26), I28 (= I28), D30 (= D30)
- binding 1-O-alpha-D-glucopyranosyl-D-fructose: D61 (= D61), Y64 (= Y64), H104 (= H104), F164 (= F165), D200 (= D201), E254 (= E264), F256 (≠ Y266), R284 (≠ N293), R291 (≠ A295), H326 (= H325), D327 (= D326), E386 (= E378), R414 (= R388)
2pwdA Crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor deoxynojirmycin (see paper)
37% identity, 94% coverage: 6:499/524 of query aligns to 6:528/557 of 2pwdA
- active site: D99 (= D99), R198 (= R199), D200 (= D201), E254 (= E264), H326 (= H325), D327 (= D326)
- binding calcium ion: D22 (= D22), N24 (= N24), D26 (= D26), I28 (= I28), D30 (= D30)
- binding 1-deoxynojirimycin: D61 (= D61), Y64 (= Y64), H104 (= H104), F164 (= F165), D200 (= D201), E254 (= E264), H326 (= H325), D327 (= D326), R414 (= R388)
8ibkA Crystal structure of bacillus sp. Ahu2216 gh13_31 alpha-glucosidase e256q/n258g in complex with maltotriose (see paper)
36% identity, 92% coverage: 5:488/524 of query aligns to 2:508/546 of 8ibkA
- binding calcium ion: D19 (= D22), N21 (= N24), D23 (= D26), I25 (= I28), D27 (= D30)
- binding alpha-D-glucopyranose: D58 (= D61), Y61 (= Y64), H101 (= H104), I141 (≠ R145), F161 (= F165), D197 (= D201), A198 (≠ V202), H201 (≠ L205), M227 (vs. gap), Q254 (≠ R247), Q254 (≠ R247), F280 (= F289), H320 (= H325), D321 (= D326), R405 (= R388)
Sites not aligning to the query:
6lgbA Bombyx mori gh13 sucrose hydrolase complexed with glucose (see paper)
37% identity, 99% coverage: 3:521/524 of query aligns to 3:559/565 of 6lgbA
- active site: D99 (= D99), D206 (= D201), E281 (= E264), H347 (= H325), D348 (= D326)
- binding calcium ion: N103 (= N103), D176 (= D171), Y210 (≠ L205), L211 (= L206), E213 (≠ K208)
- binding alpha-D-glucopyranose: D61 (= D61), Y64 (= Y64), H104 (= H104), F170 (= F165), E281 (= E264), H347 (= H325), D348 (= D326), R414 (= R388)
- binding magnesium ion: D22 (= D22), D24 (≠ N24), D26 (= D26), I28 (= I28), D30 (= D30)
2pweA Crystal structure of the mutb e254q mutant in complex with the substrate sucrose (see paper)
37% identity, 94% coverage: 6:499/524 of query aligns to 5:527/556 of 2pweA
- active site: D98 (= D99), R197 (= R199), D199 (= D201), Q253 (≠ E264), H325 (= H325), D326 (= D326)
- binding calcium ion: D21 (= D22), N23 (= N24), D25 (= D26), I27 (= I28), D29 (= D30)
- binding beta-D-fructofuranose: F163 (= F165), Q253 (≠ E264), F255 (≠ Y266), D326 (= D326), R413 (= R388)
- binding alpha-D-glucopyranose: D60 (= D61), Y63 (= Y64), H103 (= H104), F163 (= F165), D199 (= D201), Q253 (≠ E264), H325 (= H325), D326 (= D326), R413 (= R388)
Query Sequence
>H281DRAFT_02777 FitnessBrowser__Burk376:H281DRAFT_02777
MSELAWWQRGVIYQVYPRSFQDSNGDGIGDLAGITSRLPYLAGLGIDAVWLSPIYPSPMA
DFGYDVADYCDIDPMFGTLGDFKQFADRAHELGLKVLLDFVPNHSSDRHPWFEESRSSRE
NPKRDWYLWRDPAPDGGPPNNWLSRMGGSAWEWDERTGQYYYHAFLREQPDLNWRNPQVR
RAMDDVLRFWLDRGVDGFRVDVLWLLIKDSQFRDNPPNPAYEPGQPEHHRQLQTYTEDQP
EVHEIVRSMRATLDEYGERVLIGEIYLPVPQLVRYYGANGDGADMPFNFQLLNAAWNAGE
IARMIRDYDSALPVHAWPNWVLGNHDNPRVASRVGAAQARVAAVLLLTLRGTPTLYYGDE
IGMTDGEISPDRVQDPAEIRQPDIGQGRDPERTPMQWDAALPGAGFTNGRSWLPISTDTS
VRAQDGDPSSMLSLYRRLLELRRSNAALVQGAIENVAASGDVLTFERHYRGQRLFIALNM
GAADAVMQPRSGVVLLSTLAGREGQALPGSGYRLAGSEAIIAAI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory