SitesBLAST
Comparing H281DRAFT_02794 FitnessBrowser__Burk376:H281DRAFT_02794 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
22% identity, 99% coverage: 4:403/403 of query aligns to 4:345/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I7), G8 (= G8), G10 (= G10), V11 (≠ I11), I12 (≠ T12), V30 (≠ F30), E31 (= E31), K32 (≠ R32), E38 (= E39), A39 (≠ T40), S40 (= S41), A43 (≠ N44), G45 (= G46), L46 (≠ Q47), V171 (≠ I220), G200 (≠ A253), G201 (= G254), W203 (≠ K256), G298 (= G357), R300 (= R359), P301 (= P360), Y326 (≠ G384), R327 (≠ H385), N328 (≠ L386), G329 (= G387), I330 (≠ W388)
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
26% identity, 73% coverage: 108:403/403 of query aligns to 62:352/368 of 4yshB
- active site: I262 (≠ V315), L283 (= L336), G305 (= G357), N335 (≠ L386), L338 (≠ T389)
- binding flavin-adenine dinucleotide: V178 (≠ I220), S206 (≠ A253), W209 (≠ K256), R307 (= R359), H332 (= H383), R334 (≠ H385), N335 (≠ L386), G336 (= G387), I337 (≠ W388), L338 (≠ T389)
- binding glycine: G249 (≠ S300), Y251 (≠ K302), Y251 (≠ K302), A264 (≠ G317), R307 (= R359), R334 (≠ H385), R334 (≠ H385)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
26% identity, 73% coverage: 108:403/403 of query aligns to 62:352/370 of 4yshA
- active site: I262 (≠ V315), L283 (= L336), G305 (= G357), N335 (≠ L386), L338 (≠ T389)
- binding flavin-adenine dinucleotide: V178 (≠ I220), S206 (≠ A253), G207 (= G254), W209 (≠ K256), R307 (= R359), H332 (= H383), R334 (≠ H385), N335 (≠ L386), G336 (= G387), I337 (≠ W388)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
26% identity, 73% coverage: 108:403/403 of query aligns to 63:354/377 of Q5L2C2
- V180 (≠ I220) binding
- R309 (= R359) binding
- 334:340 (vs. 383:389, 29% identical) binding
- R336 (≠ H385) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
23% identity, 73% coverage: 109:402/403 of query aligns to 71:346/364 of 3if9A
- binding flavin-adenine dinucleotide: P173 (≠ E219), V174 (≠ I220), S202 (≠ A253), G203 (= G254), W205 (≠ K256), F209 (= F260), G300 (= G357), R302 (= R359), H327 (= H383), F328 (≠ G384), R329 (≠ H385), N330 (≠ L386), G331 (= G387), I332 (≠ W388)
- binding glycolic acid: Y246 (≠ K302), R302 (= R359), R329 (≠ H385)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
23% identity, 73% coverage: 109:402/403 of query aligns to 71:346/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (≠ K302), R302 (= R359), R329 (≠ H385)
- binding flavin-adenine dinucleotide: V174 (≠ I220), S202 (≠ A253), G203 (= G254), W205 (≠ K256), F209 (= F260), G300 (= G357), R302 (= R359), H327 (= H383), R329 (≠ H385), N330 (≠ L386), G331 (= G387), I332 (≠ W388)
- binding phosphate ion: R89 (≠ D130), R254 (= R312)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
23% identity, 73% coverage: 109:402/403 of query aligns to 71:346/369 of O31616
- V174 (≠ I220) binding
- H244 (≠ S300) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (= R359) binding
- 327:333 (vs. 383:389, 29% identical) binding
- R329 (≠ H385) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
25% identity, 69% coverage: 126:402/403 of query aligns to 85:346/369 of S5FMM4
- S202 (≠ A253) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ W388) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ V398) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
4x9mA Oxidized l-alpha-glycerophosphate oxidase from mycoplasma pneumoniae with fad bound (see paper)
23% identity, 62% coverage: 4:254/403 of query aligns to 6:210/384 of 4x9mA
- binding flavin-adenine dinucleotide: G10 (= G8), G12 (= G10), I14 (≠ T12), E33 (= E31), K34 (≠ R32), E41 (= E39), T42 (= T40), S43 (= S41), A45 (= A43), N46 (= N44), S47 (≠ G45), V49 (≠ Q47), H51 (≠ S49), E176 (= E219), V177 (≠ I220), A209 (= A253), G210 (= G254)
- binding sn-glycerol-3-phosphate: S47 (≠ G45), H51 (≠ S49)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 212, 234, 319, 320, 346, 347, 348, 349, 350, 351, 352
- binding sn-glycerol-3-phosphate: 258, 259, 320, 348
P75063 Glycerol 3-phosphate oxidase; GlpO; L-alpha-glycerophosphate oxidase; EC 1.1.3.21 from Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) (Mycoplasmoides pneumoniae) (see paper)
23% identity, 62% coverage: 4:254/403 of query aligns to 6:210/384 of P75063
Sites not aligning to the query:
- 346:347 binding
- 352 binding
5nmxD Crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad and NADP+ (see paper)
36% identity, 15% coverage: 1:59/403 of query aligns to 1:59/409 of 5nmxD
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 65, 66, 72, 114, 115, 149, 152
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 60, 63, 64, 66, 191, 194, 195, 215, 250, 251, 252
Query Sequence
>H281DRAFT_02794 FitnessBrowser__Burk376:H281DRAFT_02794
MSRIAIIGAGITGVTTAHALAQCGHHVTVFERHRYAAMETSFANGGQLSASNAEVWNSMA
TVLKGLRWMFMRDAPLLLNPVPTWHKYSWMGEFLRQIPHYRANTVETVRLAIAAREHLFS
IAEQEGIDFDLERRGILHVYKTRKEFDAAAKVNDLLREGGLERSAVTASEVQRIEPTLHG
DFYGGFFTPSDSTGDIHKFTRGLADACVRHGVQFHYDAEIMSIEQPAEGRFSLTAHLEGE
TQRFGFERIVVCAGVKSRDFAAMLGDHVNVYPVKGYSITVCLDDATSRQRAPWVSLLDDS
AKIVTSRLGADRFRVAGTAEINGFNRDIRSARIAPLVDWTRRHFPEVSTARVIPWAGLRP
MLPSMLPKVGRGKRRGVFYNTGHGHLGWTLSAATAQAVARAIE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory