SitesBLAST
Comparing H281DRAFT_02833 FitnessBrowser__Burk376:H281DRAFT_02833 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
44% identity, 91% coverage: 40:438/438 of query aligns to 1:400/413 of 8jejC
- binding heme c: C13 (= C52), C16 (= C55), H17 (= H56), T42 (≠ S81), I44 (= I83), F60 (= F99), L64 (= L103), L75 (= L114), Y76 (= Y115), M79 (= M118), P80 (= P119), Y84 (= Y123), R122 (= R161), C162 (= C200), C165 (= C203), H166 (= H204), I186 (≠ L229), W189 (= W232), A191 (≠ G234), P192 (≠ Y235), I194 (= I237), W205 (= W248), Y213 (= Y256), R223 (≠ Q267), M228 (= M272), V303 (≠ N345), C304 (= C346), C307 (= C349), H308 (= H350), Y320 (= Y362), P321 (= P363), L323 (= L365), T327 (≠ S369), T328 (= T370), D336 (≠ N378), I341 (= I383), V345 (= V387), R347 (= R389), I354 (≠ V396), M356 (= M398), F359 (= F401), I376 (≠ L413)
- binding ubiquinone-10: M36 (= M74), P77 (= P116), S124 (≠ P163), W128 (= W167), C165 (= C203), L173 (= L216)
Sites not aligning to the query:
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
44% identity, 91% coverage: 40:438/438 of query aligns to 1:386/418 of 7w2jC
- binding heme c: C13 (= C52), C16 (= C55), H17 (= H56), T42 (≠ S81), I44 (= I83), Y55 (≠ W94), L75 (= L114), Y76 (= Y115), A78 (= A117), M79 (= M118), R122 (= R161), H161 (= H199), C162 (= C200), C165 (= C203), H166 (= H204), A191 (≠ G234), P192 (≠ Y235), R223 (≠ Q267), P227 (= P271), M228 (= M272), V289 (≠ N345), C290 (= C346), C293 (= C349), H294 (= H350), Y305 (= Y361), Y306 (= Y362), P307 (= P363), L309 (= L365), N312 (= N368), T313 (≠ S369), T314 (= T370), D322 (≠ N378), I327 (= I383), V331 (= V387), R333 (= R389), I340 (≠ V396), M342 (= M398), P343 (= P399), F345 (= F401)
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
41% identity, 98% coverage: 8:438/438 of query aligns to 18:434/478 of Q47945
- Q37 (= Q27) modified: Pyrrolidone carboxylic acid
Sites not aligning to the query:
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
42% identity, 92% coverage: 36:438/438 of query aligns to 2:396/433 of 8gy2B
- binding heme c: C18 (= C52), C21 (= C55), H22 (= H56), T46 (≠ S81), I48 (= I83), Y59 (≠ W94), L68 (= L103), R73 (≠ S108), V79 (≠ L114), Y80 (= Y115), M83 (= M118), F88 (≠ Y123), R126 (= R161), H165 (= H199), C166 (= C200), C169 (= C203), H170 (= H204), I201 (≠ D233), A202 (≠ G234), P203 (≠ Y235), L205 (≠ I237), W216 (= W248), F224 (≠ Y256), A234 (= A266), V235 (≠ Q267), F236 (≠ A268), F236 (≠ A268), M239 (= M272), N301 (= N345), C302 (= C346), C305 (= C349), H306 (= H350), M316 (≠ Y361), F317 (≠ Y362), P318 (= P363), L320 (= L365), P324 (≠ S369), G342 (vs. gap), S352 (≠ N394), V354 (= V396), M356 (= M398), F359 (= F401), M375 (≠ V417)
- binding ubiquinone-10: C21 (= C55), L34 (= L68), P39 (= P73), P81 (= P116), L129 (= L164), W132 (= W167), E168 (≠ T202), R173 (= R207), I197 (≠ L229), D241 (≠ E274)
Sites not aligning to the query:
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
36% identity, 92% coverage: 13:417/438 of query aligns to 18:407/440 of 8gy3A
- binding heme c: Y52 (≠ D51), C53 (= C52), C56 (= C55), H57 (= H56), S84 (= S81), I86 (= I83), W97 (= W94), F102 (= F99), L117 (= L114), F121 (≠ M118), F126 (≠ Y123), R163 (= R161), C203 (= C200), C206 (= C203), H207 (= H204), A232 (≠ G234), P233 (≠ Y235), L235 (≠ I237), W245 (= W248), Y253 (= Y256), L254 (= L257), G263 (≠ A266), S264 (≠ Q267), M269 (= M272), Y292 (≠ V295), C337 (= C346), C340 (= C349), H341 (= H350), P353 (= P363), L355 (= L365), N358 (= N368), N359 (≠ S369), V372 (= V382), I377 (≠ V387), G382 (≠ A392), Q383 (≠ G393), I386 (≠ V396), M388 (= M398), F391 (= F401)
- binding ubiquinone-10: E55 (≠ A54), T76 (≠ V72), F78 (≠ L75), Y118 (= Y115), P119 (= P116), I160 (≠ L158), G166 (vs. gap), Q167 (≠ L164), F169 (≠ V166), W170 (= W167), H202 (= H199), R210 (= R207), L213 (≠ A210)
8hddB Complex structure of catalytic, small, and a partial electron transfer subunits from burkholderia cepacia fad glucose dehydrogenase
74% identity, 28% coverage: 317:438/438 of query aligns to 1:121/121 of 8hddB
- binding protoporphyrin ix containing fe: C30 (= C346), C33 (= C349), H34 (= H350), Y46 (= Y362), P47 (= P363), T54 (= T370), V66 (= V382), I67 (= I383), R73 (= R389), I80 (≠ V396), M82 (= M398), P83 (= P399)
4ax3D Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.6 a resolution (see paper)
38% identity, 22% coverage: 341:438/438 of query aligns to 358:455/457 of 4ax3D
- binding heme c: C363 (= C346), C366 (= C349), H367 (= H350), P379 (= P363), P380 (= P364), L381 (= L365), S384 (≠ N368), F386 (≠ T370), N403 (≠ Q388), G404 (≠ R389), S415 (≠ V396), M417 (= M398), M420 (≠ F401)
Sites not aligning to the query:
- active site: 93, 96, 98, 133, 134, 142, 147, 239, 261, 262, 288
- binding copper (ii) ion: 93, 98, 133, 134, 142, 147
5oboA Crystal structure of nitrite bound d97n mutant of three-domain heme-cu nitrite reductase from ralstonia pickettii
38% identity, 22% coverage: 341:438/438 of query aligns to 356:453/456 of 5oboA
- binding heme c: T360 (≠ N345), C361 (= C346), C364 (= C349), H365 (= H350), P377 (= P363), P378 (= P364), L379 (= L365), S382 (≠ N368), F384 (≠ T370), I395 (≠ V382), N401 (≠ Q388), G402 (≠ R389), S413 (≠ V396), M415 (= M398), M418 (≠ F401)
Sites not aligning to the query:
- active site: 91, 94, 96, 131, 132, 140, 145, 237, 259, 260, 286
- binding copper (ii) ion: 91, 96, 131, 132, 140, 145
- binding nitrite ion: 94, 96, 131
6fjaA Crystal structure of t2d three-domain heme-cu nitrite reductase from ralstonia pickettii
38% identity, 22% coverage: 341:438/438 of query aligns to 355:452/455 of 6fjaA
- binding protoporphyrin ix containing fe: T359 (≠ N345), C360 (= C346), C363 (= C349), H364 (= H350), P376 (= P363), P377 (= P364), L378 (= L365), F383 (≠ T370), N400 (≠ Q388), G401 (≠ R389), Y410 (vs. gap), S412 (≠ V396), M414 (= M398), M417 (≠ F401)
Sites not aligning to the query:
- active site: 90, 93, 95, 130, 131, 139, 144, 236, 258, 259, 285
- binding copper (ii) ion: 90, 131, 139, 144
2zooA Crystal structure of nitrite reductase from pseudoalteromonas haloplanktis tac125
36% identity, 23% coverage: 340:438/438 of query aligns to 341:438/438 of 2zooA
- binding protoporphyrin ix containing fe: C347 (= C346), C350 (= C349), H351 (= H350), F362 (≠ Y362), P363 (= P363), P364 (= P364), L365 (= L365), S368 (≠ N368), Y370 (≠ T370), I382 (= I383), L386 (≠ V387), S387 (≠ Q388), G388 (≠ R389), I390 (≠ A391), V392 (≠ G393), Y397 (vs. gap), N398 (vs. gap), G399 (vs. gap), V400 (vs. gap), M401 (= M398)
Sites not aligning to the query:
- active site: 81, 84, 86, 121, 122, 130, 135, 227, 249, 250, 276
- binding copper (ii) ion: 81, 86, 121, 122, 130, 135
1dt1A Thermus thermophilus cytochrome c552 synthesized by escherichia coli (see paper)
37% identity, 20% coverage: 337:423/438 of query aligns to 1:91/129 of 1dt1A
- binding heme c: C9 (= C346), C12 (= C349), H13 (= H350), P25 (= P363), H30 (= H367), Y43 (vs. gap), V47 (= V382), Q53 (= Q388), G54 (≠ R389), G65 (= G397), M67 (≠ P399), F70 (≠ A402)
Sites not aligning to the query:
1r0qA Characterization of the conversion of the malformed, recombinant cytochrome rc552 to a 2-formyl-4-vinyl (spirographis) heme (see paper)
37% identity, 20% coverage: 337:423/438 of query aligns to 2:92/130 of 1r0qA
- binding 2-formyl-protoporphryn ix: C13 (= C349), H14 (= H350), P26 (= P363), L28 (= L365), H31 (= H367), Y44 (vs. gap), V48 (= V382), Q54 (= Q388), G55 (≠ R389), G66 (= G397), M68 (≠ P399)
Sites not aligning to the query:
1qyzA Characterization of the malformed, recombinant cytochrome rc552 (see paper)
37% identity, 20% coverage: 337:423/438 of query aligns to 2:92/130 of 1qyzA
- binding 2-acetyl-protoporphyrin ix: Y7 (= Y342), C10 (= C346), C13 (= C349), H14 (= H350), P26 (= P363), H31 (= H367), Y44 (vs. gap), Q54 (= Q388), G55 (≠ R389), G66 (= G397), M68 (≠ P399), F71 (≠ A402)
Sites not aligning to the query:
1c52A Thermus thermophilus cytochrome-c552: a new highly thermostable cytochromE-C structure obtained by mad phasing (see paper)
37% identity, 20% coverage: 337:423/438 of query aligns to 3:93/131 of 1c52A
- binding protoporphyrin ix containing fe: C11 (= C346), C14 (= C349), H15 (= H350), F26 (≠ Y362), P27 (= P363), L29 (= L365), H32 (= H367), Y45 (vs. gap), L54 (≠ V387), Q55 (= Q388), G56 (≠ R389), G67 (= G397), M69 (≠ P399), F72 (≠ A402)
Sites not aligning to the query:
Query Sequence
>H281DRAFT_02833 FitnessBrowser__Burk376:H281DRAFT_02833
VLKKTFFWMLSGAFAWSSALPVCAFAQDAKAVDGNDAALIKRGEYLATAGDCMACHTTAK
GKPFAGGLPLKVPMLGTIYSSNITPDPQTGIGTWSLEDFDRALRKGVSKDGHNLYPAMPY
VSYAKVSDGDVKALYAYFRYGVVPVQQATRASDIAWPLNMRWPLTVWNWMFLKSGPYQAK
PQQSAEWNRGAYLVQGLAHCSTCHTPRGFAMQEQALDETGSGFLGGSVLADWDGYNITSS
PDSGIGGWSHTQLVQYLQTGSVPGLAQAAGPMAEAVEHSFSKMSDADIGAIATYVRTVPP
VNDGGAQSGSRSRSAWGKPSTDVARLRGVAMNDGTLDPARLYLGNCATCHQASGKGTPDG
YYPPLLHNSTVGASNPGNLMQVILHGVQRKAAGNDVGMPAFAAQLNDAQIAALTNYVTTQ
FGNPAAQRVSEKDVARLR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory