SitesBLAST
Comparing H281DRAFT_02886 FitnessBrowser__Burk376:H281DRAFT_02886 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1rqxC Crystal structure of acc deaminase complexed with inhibitor (see paper)
95% identity, 100% coverage: 1:338/338 of query aligns to 1:338/338 of 1rqxC
- active site: K51 (= K51), Y268 (= Y268), Y294 (= Y294)
- binding 1-aminocyclopropylphosphonate: K51 (= K51), S78 (= S78), N79 (= N79), Q80 (= Q80), T199 (= T199), Y294 (= Y294)
- binding pyridoxal-5'-phosphate: N50 (= N50), K51 (= K51), K54 (= K54), N79 (= N79), S197 (= S197), V198 (= V198), T199 (= T199), G200 (= G200), T202 (= T202), Y294 (= Y294), E295 (= E295), L322 (= L322), G323 (= G323), G324 (= G324)
1tzmA Crystal structure of acc deaminase complexed with substrate analog b- chloro-d-alanine (see paper)
93% identity, 100% coverage: 1:338/338 of query aligns to 1:331/331 of 1tzmA
- active site: K51 (= K51), Y261 (= Y268), Y287 (= Y294)
- binding 3-chloro-D-alanine: G74 (= G74), S78 (= S78), N79 (= N79), Q80 (= Q80), W102 (= W102), A153 (= A160), G154 (= G161), Y287 (= Y294)
- binding amino-acrylate: K51 (= K51), S78 (= S78), Q80 (= Q80), Y287 (= Y294)
- binding pyridoxal-5'-phosphate: N50 (= N50), K51 (= K51), K54 (= K54), N79 (= N79), C189 (= C196), S190 (= S197), V191 (= V198), T192 (= T199), G193 (= G200), T195 (= T202), Y287 (= Y294), E288 (= E295), L315 (= L322), G316 (= G323), G317 (= G324)
1tzkA Crystal structure of 1-aminocyclopropane-1-carboxylate-deaminase complexed with alpha-keto-butyrate (see paper)
93% identity, 100% coverage: 1:338/338 of query aligns to 1:331/331 of 1tzkA
- active site: K51 (= K51), Y261 (= Y268), Y287 (= Y294)
- binding 2-ketobutyric acid: K51 (= K51), G74 (= G74), S78 (= S78), N79 (= N79), Q80 (= Q80), A153 (= A160), G154 (= G161), Y287 (= Y294)
- binding pyridoxal-5'-phosphate: N50 (= N50), K51 (= K51), K54 (= K54), N79 (= N79), C189 (= C196), S190 (= S197), V191 (= V198), T192 (= T199), G193 (= G200), T195 (= T202), Y287 (= Y294), E288 (= E295), L315 (= L322), G316 (= G323), G317 (= G324)
1tzjA Crystal structure of 1-aminocyclopropane-1-carboxylate deaminase complexed with d-vinyl glycine (see paper)
93% identity, 100% coverage: 1:338/338 of query aligns to 1:331/331 of 1tzjA
- active site: K51 (= K51), Y261 (= Y268), Y287 (= Y294)
- binding d-vinylglycine: G74 (= G74), S78 (= S78), N79 (= N79), Q80 (= Q80), A153 (= A160), G154 (= G161), Y287 (= Y294)
- binding pyridoxal-5'-phosphate: N50 (= N50), K51 (= K51), K54 (= K54), N79 (= N79), C189 (= C196), S190 (= S197), V191 (= V198), T192 (= T199), G193 (= G200), T195 (= T202), Y287 (= Y294), E288 (= E295), L315 (= L322), G316 (= G323), G317 (= G324)
1tz2A Crystal structure of 1-aminocyclopropane-1-carboyxlate deaminase complexed with acc (see paper)
93% identity, 100% coverage: 1:338/338 of query aligns to 1:331/331 of 1tz2A
- active site: K51 (= K51), Y261 (= Y268), Y287 (= Y294)
- binding 1-aminocyclopropanecarboxylic acid: K51 (= K51), S78 (= S78), Y287 (= Y294)
- binding pyridoxal-5'-phosphate: N50 (= N50), K51 (= K51), K54 (= K54), N79 (= N79), C189 (= C196), S190 (= S197), V191 (= V198), T192 (= T199), G193 (= G200), T195 (= T202), Y287 (= Y294), E288 (= E295), L315 (= L322), G316 (= G323), G317 (= G324)
Q5PWZ8 1-aminocyclopropane-1-carboxylate deaminase; ACC deaminase; ACCD; EC 3.5.99.7 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
83% identity, 100% coverage: 1:338/338 of query aligns to 1:338/338 of Q5PWZ8
- G44 (= G44) mutation to D: Loss of activity.
1f2dA 1-aminocyclopropane-1-carboxylate deaminase (see paper)
61% identity, 99% coverage: 3:335/338 of query aligns to 3:336/341 of 1f2dA
- active site: K51 (= K51), Y269 (= Y268), Y295 (= Y294)
- binding pyridoxal-5'-phosphate: N50 (= N50), K51 (= K51), K54 (= K54), N79 (= N79), C200 (≠ S197), T202 (= T199), G203 (= G200), S204 (= S201), T205 (= T202), Y295 (= Y294), E296 (= E295), L323 (= L322), G324 (= G323), G325 (= G324)
Q7M523 1-aminocyclopropane-1-carboxylate deaminase; ACC deaminase; ACCD; EC 3.5.99.7 from Cyberlindnera saturnus (Yeast) (Williopsis saturnus) (see paper)
61% identity, 99% coverage: 3:335/338 of query aligns to 3:336/341 of Q7M523
Sites not aligning to the query:
- 1 modified: N-acetylserine
1j0eA Acc deaminase mutant reacton intermediate (see paper)
61% identity, 99% coverage: 3:335/338 of query aligns to 3:336/341 of 1j0eA
- binding 1-aminocyclopropanecarboxylic acid: S78 (= S78), N79 (= N79), Q80 (= Q80), F295 (≠ Y294)
- binding pyridoxal-5'-phosphate: N50 (= N50), K51 (= K51), K54 (= K54), N79 (= N79), C199 (= C196), T202 (= T199), G203 (= G200), T205 (= T202), F295 (≠ Y294), E296 (= E295)
1j0dA Acc deaminase mutant complexed with acc (see paper)
61% identity, 99% coverage: 3:335/338 of query aligns to 3:336/341 of 1j0dA
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-y-lmethyl]-1-amino-cyclopropanecarboxylic acid: S78 (= S78), N79 (= N79), Q80 (= Q80), A163 (= A160), G164 (= G161), C200 (≠ S197), V201 (= V198), T202 (= T199), G203 (= G200), S204 (= S201), T205 (= T202), Y295 (= Y294), E296 (= E295)
4d8uH Crystal structure of d-cysteine desulfhydrase from salmonella typhimurium at 3.3 a in monoclinic space group with 8 subunits in the asymmetric unit (see paper)
37% identity, 98% coverage: 2:331/338 of query aligns to 8:327/331 of 4d8uH
4d9fA D-cysteine desulfhydrase from salmonella typhimurium complexed with d- cycloserine (dcs) (see paper)
37% identity, 98% coverage: 2:331/338 of query aligns to 5:324/328 of 4d9fA
- active site: K51 (= K51), Y261 (= Y268), Y287 (= Y294)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: N50 (= N50), K51 (= K51), K54 (= K54), N79 (= N79), G194 (≠ V198), S195 (≠ T199), A196 (≠ G200), T198 (= T202), Y287 (= Y294), T315 (≠ L322), G316 (= G323), G317 (= G324)
4d9eA D-cysteine desulfhydrase from salmonella typhimurium complexed with l- cycloserine (lcs) (see paper)
37% identity, 98% coverage: 2:331/338 of query aligns to 5:324/328 of 4d9eA
- active site: K51 (= K51), Y261 (= Y268), Y287 (= Y294)
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: N50 (= N50), K51 (= K51), N79 (= N79), G194 (≠ V198), S195 (≠ T199), A196 (≠ G200), T198 (= T202), Y287 (= Y294), T315 (≠ L322), G316 (= G323), G317 (= G324)
4d9bA Pyridoxamine 5' phosphate (pmp) bound form of salmonella typhimurium d-cysteine desulfhydrase obtained after co-crystallization with d- cycloserine (see paper)
37% identity, 98% coverage: 2:331/338 of query aligns to 5:324/328 of 4d9bA
- active site: K51 (= K51), Y261 (= Y268), Y287 (= Y294)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: N50 (= N50), K51 (= K51), N79 (= N79), G194 (≠ V198), S195 (≠ T199), A196 (≠ G200), T198 (= T202), Y287 (= Y294), T315 (≠ L322), G316 (= G323), G317 (= G324)
4d99A Salmonella typhimurium d-cysteine desulfhydrase with l-ser bound non- covalently at the active site (see paper)
37% identity, 98% coverage: 2:331/338 of query aligns to 5:324/328 of 4d99A
4d97A Salmonella typhimurium d-cysteine desulfhydrase with d-ser bound at active site (see paper)
37% identity, 98% coverage: 2:331/338 of query aligns to 5:324/328 of 4d97A
4d96A D-cysteine desulfhydrase from salmonella typhimurium complexed with 1- amino-1-carboxycyclopropane (acc) (see paper)
37% identity, 98% coverage: 2:331/338 of query aligns to 5:324/328 of 4d96A
- active site: K51 (= K51), Y261 (= Y268), Y287 (= Y294)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-y-lmethyl]-1-amino-cyclopropanecarboxylic acid: N50 (= N50), K51 (= K51), S78 (= S78), N79 (= N79), H80 (≠ Q80), G194 (≠ V198), S195 (≠ T199), A196 (≠ G200), T198 (= T202), Y287 (= Y294), T315 (≠ L322), G316 (= G323), G317 (= G324)
4d8wA Salmonella typhimurium d-cysteine desulfhydrase soaked with d-cys shows pyruvate bound 4 a away from active site (see paper)
37% identity, 98% coverage: 2:331/338 of query aligns to 5:324/328 of 4d8wA
1j0bA Crystal structure analysis of the acc deaminase homologue complexed with inhibitor (see paper)
33% identity, 96% coverage: 3:325/338 of query aligns to 9:311/325 of 1j0bA
- active site: K54 (= K51), Y256 (= Y268), Y282 (= Y294)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-y-lmethyl]-1-amino-cyclopropanecarboxylic acid: N53 (= N50), K54 (= K51), S81 (= S78), N82 (= N79), H83 (≠ Q80), A189 (≠ S197), G190 (≠ V198), S191 (≠ T199), G192 (= G200), G193 (≠ S201), T194 (= T202), Y282 (= Y294), T308 (≠ L322), G309 (= G323), G310 (= G324)
1j0aA Crystal structure analysis of the acc deaminase homologue (see paper)
33% identity, 96% coverage: 3:325/338 of query aligns to 9:311/325 of 1j0aA
- active site: K54 (= K51), Y256 (= Y268), Y282 (= Y294)
- binding pyridoxal-5'-phosphate: N53 (= N50), K54 (= K51), K57 (= K54), N82 (= N79), G190 (≠ V198), S191 (≠ T199), G192 (= G200), G193 (≠ S201), T194 (= T202), Y282 (= Y294), T308 (≠ L322), G309 (= G323), G310 (= G324)
Query Sequence
>H281DRAFT_02886 FitnessBrowser__Burk376:H281DRAFT_02886
MNLQRFPRYPLTFGPTPIQPLKRLSDHLGGKVHLYAKREDCNSGFAFGGNKTRKLEYLIP
EALAQGCDTLVSIGGIQSNQTRQVAAVAAHLGMKCVLVQENWVNYSDAVYDRVGNIQMSR
ILGADVRLVPDGFDIGFRKSWEDALESVRAAGGKPYAIPAGCSDHPLGGLGFVGFAEEVR
QQEAELGFKFDYIVVCSVTGSTQAGMVVGFAADGRADRVIGIDASAKPAQTREQITRIAS
RTAEKVGLGRDITANDVVLDERFGGPEYGLPNDGTLEAIRLCARLEGVLTDPVYEGKSMH
GMIDMVRNGEFPEGSRVLYAHLGGVPALNGYSFIFRDG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory