SitesBLAST
Comparing H281DRAFT_02889 FitnessBrowser__Burk376:H281DRAFT_02889 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ykgA Crystal structure of the alkylhydroperoxide reductase subunit f (ahpf) with NAD+ from escherichia coli (see paper)
64% identity, 97% coverage: 1:513/530 of query aligns to 1:517/521 of 4ykgA
- active site: C345 (= C341), C348 (= C344), D349 (= D345)
- binding flavin-adenine dinucleotide: G221 (= G221), P222 (= P222), A223 (= A223), G242 (≠ A242), E243 (= E243), G247 (= G247), Q248 (= Q248), T252 (= T252), N257 (= N257), S289 (≠ R289), A290 (= A290), T322 (= T318), G323 (= G319), C348 (= C344), G487 (= G483), D488 (= D484), Q496 (= Q492), I497 (= I493)
- binding nicotinamide-adenine-dinucleotide: I361 (= I357), G364 (= G360), S366 (= S362), E385 (= E381), F386 (= F382), I449 (= I445), M467 (≠ H463), P493 (= P489)
4ykfA Crystal structure of the alkylhydroperoxide reductase subunit f (ahpf) with nadh from escherichia coli (see paper)
64% identity, 97% coverage: 1:513/530 of query aligns to 1:517/521 of 4ykfA
- active site: C345 (= C341), C348 (= C344), D349 (= D345)
- binding flavin-adenine dinucleotide: G221 (= G221), P222 (= P222), A223 (= A223), G242 (≠ A242), E243 (= E243), G247 (= G247), Q248 (= Q248), N257 (= N257), A290 (= A290), T322 (= T318), G323 (= G319), C348 (= C344), N454 (= N450), D488 (= D484), Q496 (= Q492), I497 (= I493)
- binding 1,4-dihydronicotinamide adenine dinucleotide: I361 (= I357), G364 (= G360), N365 (= N361), S366 (= S362), E385 (= E381), F386 (= F382), K391 (≠ R387), I449 (= I445), M467 (≠ H463)
P35340 Alkyl hydroperoxide reductase subunit F; Alkyl hydroperoxide reductase F52A protein; EC 1.8.1.- from Escherichia coli (strain K12) (see paper)
64% identity, 97% coverage: 1:513/530 of query aligns to 1:517/521 of P35340
- K53 (≠ I53) modified: N6-acetyllysine
- K354 (= K350) modified: N6-acetyllysine
1hyuA Crystal structure of intact ahpf (see paper)
63% identity, 97% coverage: 1:513/530 of query aligns to 1:517/521 of 1hyuA
- binding flavin-adenine dinucleotide: G221 (= G221), P222 (= P222), A223 (= A223), E243 (= E243), G247 (= G247), Q248 (= Q248), N257 (= N257), S289 (≠ R289), A290 (= A290), T322 (= T318), G323 (= G319), W326 (= W322), C345 (= C341), D488 (= D484), K495 (= K491), Q496 (= Q492), I497 (= I493)
3ctyB Crystal structure of t. Acidophilum thioredoxin reductase (see paper)
40% identity, 57% coverage: 213:512/530 of query aligns to 5:304/305 of 3ctyB
- active site: A38 (vs. gap), T42 (≠ V249), L47 (≠ A254), N50 (= N257), C133 (= C341), C136 (= C344), D137 (= D345)
- binding flavin-adenine dinucleotide: V10 (= V218), G11 (= G219), A15 (= A223), D34 (≠ A242), K35 (≠ E243), G40 (= G247), L41 (≠ Q248), T42 (≠ V249), A45 (≠ T252), P46 (≠ L253), N50 (= N257), V82 (≠ I284), T110 (= T318), G111 (= G319), S154 (= S362), Q241 (≠ N450), G275 (= G483), D276 (= D484), A283 (≠ K491), Q284 (= Q492), I285 (= I493)
7jypA Structure of thioredoxin reductase from the thermophilic eubacterium thermosipho africanus tcf52b
38% identity, 55% coverage: 210:503/530 of query aligns to 3:296/305 of 7jypA
- binding flavin-adenine dinucleotide: G12 (= G219), G14 (= G221), P15 (= P222), A16 (= A223), F34 (≠ V241), E35 (≠ A242), K36 (≠ E243), G41 (= G247), A42 (≠ Q248), V83 (≠ R289), T112 (= T318), G113 (= G319), G276 (= G483), D277 (= D484)
- binding nicotinamide-adenine-dinucleotide: G153 (= G359), G154 (= G360), S156 (= S362), Q175 (≠ E381), N176 (≠ F382), T181 (≠ R387), V238 (≠ I445)
3f8rA Crystal structure of sulfolobus solfataricus thioredoxin reductase b3 in complex with two NADP molecules (see paper)
37% identity, 56% coverage: 213:511/530 of query aligns to 7:305/308 of 3f8rA
- active site: C133 (= C341), C136 (= C344), D137 (= D345)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V12 (= V218), G13 (= G219), L14 (≠ G220), G15 (= G221), P16 (= P222), A17 (= A223), E37 (= E243), T38 (≠ R244), G41 (= G247), Q42 (= Q248), I82 (≠ V287), V83 (≠ Q288), G109 (≠ A317), I110 (≠ T318), G111 (= G319), R115 (= R323), L117 (≠ I325), D153 (≠ N361), S154 (= S362), E157 (= E365), R174 (≠ F382), R175 (≠ G383), Y184 (≠ L392), I236 (= I445), G275 (= G483), D276 (= D484), L282 (≠ V488), G283 (≠ P489), R285 (≠ K491)
3f8pD Structure of sulfolobus solfataricus trxr-b3 (see paper)
37% identity, 56% coverage: 213:511/530 of query aligns to 7:307/310 of 3f8pD
- active site: C135 (= C341), C138 (= C344), D139 (= D345)
- binding nicotinamide-adenine-dinucleotide: V12 (= V218), G13 (= G219), L14 (≠ G220), G15 (= G221), P16 (= P222), A17 (= A223), G36 (≠ A242), T38 (≠ R244), G41 (= G247), Q42 (= Q248), I82 (≠ V287), V83 (≠ Q288), G111 (≠ A317), I112 (≠ T318), G113 (= G319), G277 (= G483), D278 (= D484)
3f8dA Structure of sulfolobus solfataricus thioredoxin reductase mutant c147a (see paper)
37% identity, 56% coverage: 213:511/530 of query aligns to 7:305/308 of 3f8dA
- active site: C133 (= C341), A136 (≠ C344), D137 (= D345)
- binding flavin-adenine dinucleotide: V12 (= V218), G13 (= G219), L14 (≠ G220), G15 (= G221), P16 (= P222), A17 (= A223), G36 (≠ A242), E37 (= E243), T38 (≠ R244), G41 (= G247), Q42 (= Q248), E45 (≠ D251), A46 (≠ T252), V49 (≠ I255), D51 (≠ N257), I82 (≠ V287), V83 (≠ Q288), G109 (≠ A317), I110 (≠ T318), G111 (= G319), C133 (= C341), A136 (≠ C344), G275 (= G483), D276 (= D484), R285 (≠ K491), Q286 (= Q492), V287 (≠ I493)
5uwyA The crystal structure of thioredoxin reductase from streptococcus pyogenes mgas5005
35% identity, 57% coverage: 212:511/530 of query aligns to 4:303/306 of 5uwyA
- binding flavin-adenine dinucleotide: G13 (= G221), P14 (= P222), A15 (= A223), E34 (≠ A242), Q35 (≠ E243), G40 (= G247), Q41 (= Q248), T45 (= T252), N50 (= N257), V82 (= V287), T110 (= T318), G111 (= G319), Y114 (≠ W322), C136 (= C344), V242 (≠ N450), G275 (= G483), D276 (= D484), Q284 (= Q492), I285 (= I493)
7aawA Thioredoxin reductase from bacillus cereus (see paper)
37% identity, 58% coverage: 212:521/530 of query aligns to 6:315/315 of 7aawA
- binding flavin-adenine dinucleotide: G13 (= G219), G15 (= G221), P16 (= P222), A17 (= A223), E36 (= E243), R37 (= R244), G42 (= G247), Q43 (= Q248), T47 (= T252), N52 (= N257), G82 (≠ M285), V84 (= V287), A111 (= A317), S112 (≠ T318), G113 (= G319), C138 (= C344), G277 (= G483), D278 (= D484), Q286 (= Q492), I287 (= I493)
- binding alpha-D-glucopyranose: R27 (= R233), D49 (≠ A254), K74 (≠ T279), F75 (≠ Y280), P122 (= P328), G123 (= G329), E126 (= E332), G129 (≠ N335), G131 (= G337), V132 (= V338), F143 (= F349), E206 (= E412), N208 (≠ T414)
5mh4A Crystal structure of lactococcus lactis thioredoxin reductase (fr conformation) (see paper)
34% identity, 57% coverage: 213:512/530 of query aligns to 2:301/303 of 5mh4A
- active site: V34 (vs. gap), P35 (vs. gap), M39 (≠ V249), E44 (≠ A254), C130 (= C341), C133 (= C344), D134 (= D345)
- binding flavin-adenine dinucleotide: G10 (= G221), P11 (= P222), A12 (= A223), E31 (= E243), R32 (= R244), G37 (= G247), Q38 (= Q248), T42 (= T252), N47 (= N257), G77 (≠ A292), V79 (≠ I294), T107 (= T318), G108 (= G319), E155 (≠ A366), V239 (≠ N450), F242 (≠ W453), G272 (= G483), D273 (= D484), Q281 (= Q492), I282 (= I493)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I146 (= I357), G147 (= G358), G148 (= G359), G149 (= G360), D150 (≠ N361), S151 (= S362), E154 (= E365), H170 (≠ E381), R171 (≠ F382), R172 (≠ G383), R176 (= R387), V234 (≠ I445), G235 (= G446), R280 (≠ K491), Q281 (= Q492)
7aawB Thioredoxin reductase from bacillus cereus (see paper)
37% identity, 58% coverage: 212:520/530 of query aligns to 3:311/311 of 7aawB
- binding flavin-adenine dinucleotide: G10 (= G219), G12 (= G221), P13 (= P222), A14 (= A223), E33 (= E243), R34 (= R244), G39 (= G247), Q40 (= Q248), T44 (= T252), N49 (= N257), G79 (≠ M285), D80 (= D286), V81 (= V287), S109 (≠ T318), G110 (= G319), Y113 (≠ W322), C135 (= C344), G274 (= G483), D275 (= D484), Q283 (= Q492), I284 (= I493)
- binding alpha-D-glucopyranose: D46 (≠ A254), E48 (= E256), G126 (≠ N335), G128 (= G337), D136 (= D345), A138 (≠ P347), F139 (≠ L348), F139 (≠ L348), F140 (= F349)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G359), G151 (= G360), D152 (≠ N361), S153 (= S362), E156 (= E365), H172 (≠ E381), R173 (≠ F382), R174 (≠ G383), R178 (= R387), I236 (= I445)
2q7vA Crystal structure of deinococcus radiodurans thioredoxin reductase (see paper)
36% identity, 55% coverage: 213:505/530 of query aligns to 8:304/313 of 2q7vA
- active site: P41 (vs. gap), I45 (≠ V249), E50 (≠ A254), C141 (= C341), C144 (= C344), D145 (= D345)
- binding flavin-adenine dinucleotide: G16 (= G221), P17 (= P222), A18 (= A223), E37 (≠ A242), K38 (≠ E243), G43 (= G247), Q44 (= Q248), I45 (≠ V249), N53 (= N257), E85 (≠ D286), V86 (= V287), T118 (= T318), G119 (= G319), C144 (= C344), G282 (= G483), D283 (= D484), Q291 (= Q492), L292 (≠ I493), S295 (≠ A496)
4gcmB Crystal structure of a thioredoxine reductase (trxb) from staphylococcus aureus subsp. Aureus mu50 at 1.80 a resolution
36% identity, 56% coverage: 213:511/530 of query aligns to 5:303/309 of 4gcmB
- active site: C133 (= C341), C136 (= C344), D137 (= D345)
- binding flavin-adenine dinucleotide: G11 (= G219), G13 (= G221), P14 (= P222), A15 (= A223), E34 (= E243), R35 (= R244), G40 (= G247), Q41 (= Q248), T45 (= T252), N50 (= N257), D81 (= D286), I82 (≠ V287), T110 (= T318), G111 (= G319), C136 (= C344), G275 (= G483), D276 (= D484), Q284 (= Q492), I285 (= I493)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I117 (= I325), G151 (= G359), G152 (= G360), D153 (≠ N361), S154 (= S362), E157 (= E365), R174 (≠ F382), R175 (≠ G383), R179 (= R387), Q181 (≠ D389), I237 (= I445)
5uthA Crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad
34% identity, 56% coverage: 210:507/530 of query aligns to 1:299/306 of 5uthA
- active site: C133 (= C341), C136 (= C344), D137 (= D345)
- binding flavin-adenine dinucleotide: I9 (≠ V218), G10 (= G219), S11 (≠ G220), G12 (= G221), P13 (= P222), A14 (= A223), F32 (≠ V241), E33 (vs. gap), G34 (≠ A242), Q36 (≠ R244), G39 (= G247), A40 (≠ Q248), L41 (≠ V249), N49 (= N257), D81 (≠ Q288), V82 (≠ R289), M110 (≠ T318), G111 (= G319), C136 (= C344), G275 (= G483), D276 (= D484), R283 (≠ K491), Q284 (= Q492), A285 (≠ I493), A288 (= A496)
8ccmA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with compound 2-06
34% identity, 56% coverage: 212:507/530 of query aligns to 2:298/305 of 8ccmA
- binding flavin-adenine dinucleotide: I8 (≠ V218), G9 (= G219), S10 (≠ G220), G11 (= G221), P12 (= P222), A13 (= A223), E32 (vs. gap), G33 (≠ A242), Q35 (≠ R244), G38 (= G247), A39 (≠ Q248), L40 (≠ V249), T43 (= T252), N48 (= N257), D80 (≠ Q288), V81 (≠ R289), M109 (≠ T318), G110 (= G319), T131 (≠ Y340), C135 (= C344), G274 (= G483), D275 (= D484), R282 (≠ K491), Q283 (= Q492), A284 (≠ I493), A287 (= A496)
- binding ~{N}6-(4-aminophenyl)-1,2-benzothiazole-3,6-diamine: R114 (= R323), H115 (≠ E324), L116 (≠ I325), R173 (≠ F382), E200 (≠ Q409), I201 (≠ T410), I235 (= I445)
8cclA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry a09
34% identity, 56% coverage: 212:507/530 of query aligns to 2:298/305 of 8cclA
- binding flavin-adenine dinucleotide: I8 (≠ V218), G9 (= G219), S10 (≠ G220), G11 (= G221), P12 (= P222), A13 (= A223), E32 (vs. gap), G33 (≠ A242), Q35 (≠ R244), G38 (= G247), A39 (≠ Q248), L40 (≠ V249), T43 (= T252), N48 (= N257), D80 (≠ Q288), V81 (≠ R289), M109 (≠ T318), G110 (= G319), T131 (≠ Y340), C135 (= C344), G274 (= G483), D275 (= D484), R282 (≠ K491), Q283 (= Q492), A284 (≠ I493), A287 (= A496)
- binding [1,2]thiazolo[5,4-b]pyridin-3-amine: L116 (≠ I325), R173 (≠ F382), E200 (≠ Q409), I201 (≠ T410)
8cckA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry h07
34% identity, 56% coverage: 212:507/530 of query aligns to 2:298/305 of 8cckA
- binding flavin-adenine dinucleotide: G9 (= G219), S10 (≠ G220), G11 (= G221), P12 (= P222), A13 (= A223), E32 (vs. gap), G33 (≠ A242), Q35 (≠ R244), G38 (= G247), A39 (≠ Q248), L40 (≠ V249), T43 (= T252), N48 (= N257), D80 (≠ Q288), V81 (≠ R289), M109 (≠ T318), G110 (= G319), T131 (≠ Y340), C135 (= C344), G274 (= G483), D275 (= D484), R282 (≠ K491), Q283 (= Q492), A284 (≠ I493), A287 (= A496)
- binding ~{N}-(4-hydroxyphenyl)-2-pyrazol-1-yl-ethanamide: R114 (= R323), H115 (≠ E324), L116 (≠ I325), V148 (≠ I357), R173 (≠ F382), E200 (≠ Q409), I201 (≠ T410)
8ccjA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with NADPH
34% identity, 56% coverage: 212:507/530 of query aligns to 2:298/305 of 8ccjA
- binding flavin-adenine dinucleotide: I8 (≠ V218), G9 (= G219), S10 (≠ G220), G11 (= G221), P12 (= P222), A13 (= A223), E32 (vs. gap), G33 (≠ A242), Q35 (≠ R244), G38 (= G247), A39 (≠ Q248), L40 (≠ V249), T43 (= T252), N48 (= N257), D80 (≠ Q288), V81 (≠ R289), M109 (≠ T318), G110 (= G319), T131 (≠ Y340), C135 (= C344), G274 (= G483), D275 (= D484), R282 (≠ K491), Q283 (= Q492), A284 (≠ I493), A287 (= A496)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G359), G151 (= G360), D152 (≠ N361), S153 (= S362), E156 (= E365), H172 (≠ E381), R173 (≠ F382), R174 (≠ G383), R178 (= R387), I235 (= I445)
Query Sequence
>H281DRAFT_02889 FitnessBrowser__Burk376:H281DRAFT_02889
MLDANLKTQLKTYLEKVSRPIEIVASLDDSAKSQELLALLNDIATLSERVTVIERRGDSE
RKPSFSIGEPGKDIGIRFAGIPMGHEFTSLVLALLQVGGHPVKLDDAVIEQIRSLDGDYQ
FETYFSLSCQNCPEVVQALNVMALINPRIRHVAIDGALFQNEVDARQIMAVPTMFLNGEV
FGQGRSGVKEILAKLDTNAGARAAKELENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTLAIENFVSVTETEGPKFATALEQHVKTYEVDIMDVQRAEALIPGRINE
VRLANGAVLKAKTIILATGARWREINVPGEREYRNHGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGIVREVTLFEFGATLRADEVLQRKLRSLANVTIVTQAQTTEITGDGKKV
NGLVYKDLRSGEVKNVELEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLSAFDHLIRNSEETETVSEVEAEAAV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory