Comparing H281DRAFT_02940 FitnessBrowser__Burk376:H281DRAFT_02940 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
5ugrA Malyl-coa lyase from methylobacterium extorquens (see paper)
42% identity, 98% coverage: 2:305/310 of query aligns to 11:317/323 of 5ugrA
4l9yC Crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa (see paper)
36% identity, 98% coverage: 2:305/310 of query aligns to 11:312/316 of 4l9yC
Q3J5L6 L-malyl-CoA/beta-methylmalyl-CoA lyase; (3S)-malyl-CoA/beta-methylmalyl-CoA lyase; (S)-citramalyl-CoA lyase; EC 4.1.3.24; EC 4.1.3.25 from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
36% identity, 98% coverage: 2:305/310 of query aligns to 12:313/318 of Q3J5L6
4l9zA Crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, oxalate, and coa (see paper)
36% identity, 98% coverage: 2:305/310 of query aligns to 10:311/313 of 4l9zA
4l9yA Crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa (see paper)
36% identity, 98% coverage: 2:305/310 of query aligns to 11:312/314 of 4l9yA
4l80C Crystal structure of chloroflexus aurantiacus malyl-coa lyase in complex with magnesium, oxalate, and propionyl-coa (see paper)
32% identity, 98% coverage: 1:305/310 of query aligns to 24:331/347 of 4l80C
S5N020 Malyl-CoA/beta-methylmalyl-CoA/citramalyl-CoA lyase; (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase; (3S)-citramalyl-CoA pyruvate-lyase; (S)-citramalyl-CoA lyase; Erythro-beta-methylmalyl-CoA; L-malyl-CoA lyase; EC 4.1.3.24; EC 4.1.3.25 from Chloroflexus aurantiacus (see paper)
32% identity, 98% coverage: 1:305/310 of query aligns to 25:332/348 of S5N020
5vxoA Crystal structure analysis of human clybl in complex with propionyl- coa (see paper)
30% identity, 98% coverage: 5:308/310 of query aligns to 7:298/298 of 5vxoA
5vxcA Crystal structure analysis of human clybl in complex with free coash (see paper)
30% identity, 98% coverage: 5:308/310 of query aligns to 7:298/301 of 5vxcA
Q8N0X4 Citramalyl-CoA lyase, mitochondrial; (3S)-malyl-CoA thioesterase; Beta-methylmalate synthase; Citrate lyase subunit beta-like protein; Citrate lyase beta-like; Malate synthase; EC 4.1.3.25; EC 3.1.2.30; EC 2.3.3.-; EC 2.3.3.9 from Homo sapiens (Human) (see 5 papers)
30% identity, 98% coverage: 5:308/310 of query aligns to 46:337/340 of Q8N0X4
Sites not aligning to the query:
Q9RUZ0 Citrate lyase subunit beta-like protein; EC 4.1.-.- from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
29% identity, 93% coverage: 5:291/310 of query aligns to 9:269/284 of Q9RUZ0
1sgjB Crystal structure of citrate lyase beta subunit
29% identity, 79% coverage: 5:248/310 of query aligns to 6:223/231 of 1sgjB
1sgjA Crystal structure of citrate lyase beta subunit
29% identity, 79% coverage: 5:248/310 of query aligns to 6:223/231 of 1sgjA
6aq4B Crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium, pyruvate and citramalyl-coa (see paper)
30% identity, 85% coverage: 27:291/310 of query aligns to 29:253/268 of 6aq4B
Sites not aligning to the query:
6aq4C Crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium, pyruvate and citramalyl-coa (see paper)
30% identity, 85% coverage: 27:291/310 of query aligns to 29:253/267 of 6aq4C
6as5A Crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium, acetoacetate and coenzyme a (see paper)
30% identity, 85% coverage: 27:291/310 of query aligns to 27:251/267 of 6as5A
Sites not aligning to the query:
6arbA Crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium, pyruvate and coenzyme a (see paper)
30% identity, 85% coverage: 27:291/310 of query aligns to 28:252/268 of 6arbA
Sites not aligning to the query:
>H281DRAFT_02940 FitnessBrowser__Burk376:H281DRAFT_02940
MRVTRTFLAVPAHQRRMVESAARSSADAVFLDLEDAVPQAQKETALLGAVAAINELDWGH
KAVSVRVNVPASATIETEVARLLTDAPRLDTLLVPKVECTADVDRVVGLIKLHSQRRRTP
IGLEVMIETALGLVNCEQIAAHSELIESLHFGVGDFSASIGAKGVDIGLSHPGYRLTARS
AQGDYSSTALDMWAYPMMRILVAARAHRLRAIDGPCGAFHDSDLTSALAVKAATMGFDGK
QVIHPCQIDTTLRAFVPTADELCEAQRVIAAMTEAEREGRGAVQVDGKLVDYANIRMAQR
VVAMAANVDL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory