Comparing H281DRAFT_02952 FitnessBrowser__Burk376:H281DRAFT_02952 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
4im7A Crystal structure of fructuronate reductase (ydfi) from e. Coli cft073 (efi target efi-506389) complexed with nadh and d-mannonate
45% identity, 93% coverage: 21:482/497 of query aligns to 9:472/483 of 4im7A
7rk5B Mannitol-2-dehydrogenase bound to nadh from aspergillus fumigatus
39% identity, 98% coverage: 1:487/497 of query aligns to 3:494/501 of 7rk5B
1m2wA Pseudomonas fluorescens mannitol 2-dehydrogenase ternary complex with NAD and d-mannitol (see paper)
39% identity, 98% coverage: 1:487/497 of query aligns to 1:485/492 of 1m2wA
1lj8A Crystal structure of mannitol dehydrogenase in complex with NAD (see paper)
39% identity, 98% coverage: 1:487/497 of query aligns to 1:485/492 of 1lj8A
P09424 Mannitol-1-phosphate 5-dehydrogenase; EC 1.1.1.17 from Escherichia coli (strain K12) (see paper)
24% identity, 50% coverage: 161:410/497 of query aligns to 96:334/382 of P09424
Q4X1A4 Mannitol-1-phosphate 5-dehydrogenase; M1PDH; MPD; MPDH; EC 1.1.1.17 from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata) (see paper)
21% identity, 44% coverage: 182:400/497 of query aligns to 115:325/388 of Q4X1A4
7ocnA Crystal structure of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
28% identity, 32% coverage: 295:451/497 of query aligns to 523:689/690 of 7ocnA
Sites not aligning to the query:
7ocqA Nadh bound to the dehydrogenase domain of the bifunctional mannitol-1- phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
28% identity, 32% coverage: 295:451/497 of query aligns to 519:685/686 of 7ocqA
Sites not aligning to the query:
7ocsA Mannitol-1-phosphate bound to the phosphatase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld-d16a from acinetobacter baumannii (see paper)
28% identity, 32% coverage: 295:451/497 of query aligns to 515:681/682 of 7ocsA
Sites not aligning to the query:
7ocrB NADPH and fructose-6-phosphate bound to the dehydrogenase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
28% identity, 32% coverage: 295:451/497 of query aligns to 508:674/675 of 7ocrB
Sites not aligning to the query:
7ocqB Nadh bound to the dehydrogenase domain of the bifunctional mannitol-1- phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
28% identity, 32% coverage: 295:451/497 of query aligns to 512:678/679 of 7ocqB
Sites not aligning to the query:
>H281DRAFT_02952 FitnessBrowser__Burk376:H281DRAFT_02952
MRLSNAFVASLAAPAARGIVVPTYDRASLAPGIVHLGLGAFHRAHQAVYTEHTLRAGDHR
WGIVGVSLRRADTSEALTAQDHLYTVDVRDGAADSFQVVGALIASLVAPQSPAAVLDAMT
DPRGHIVSLTITEKGYCRNPASGALEFDHPDIDHDLREGSAPRSAIGFVVRALALRRAAG
LRPLTVMSCDNLPSNGDTMRALTLAFAREADPALADWIEREGAFPNTMVDRIVPLTTDAD
RTRVAEELGAYDAWPVITEPFSQWVIEDRFAGPRPAWERAGATLVRDARPYEQAKLRMLN
GAHSALAYLGSLIGYDTVDQAIGAPALLNFVESMLRDEVEPTLSRPALARYRADLFTRFR
NTALDHRLQQIATDGSQKLPQRWLESVRANLKSGAPTECLAFALAGWIAYLGGQDETGRT
YVIADPLAGTLAEAVRLTLHADAIDAVQALFEIESIFGCDLRAHPRFVAQVAAHLAAIRA
EGVVKALDACTVSRSCT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory