Comparing H281DRAFT_02965 FitnessBrowser__Burk376:H281DRAFT_02965 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
31% identity, 95% coverage: 12:512/526 of query aligns to 2:484/501 of P04983
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 41% coverage: 14:228/526 of query aligns to 4:231/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 41% coverage: 14:228/526 of query aligns to 4:231/253 of 1g9xB
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 41% coverage: 13:226/526 of query aligns to 1:215/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 37% coverage: 14:207/526 of query aligns to 1:196/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 45% coverage: 14:251/526 of query aligns to 3:233/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 45% coverage: 14:251/526 of query aligns to 3:233/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 45% coverage: 14:251/526 of query aligns to 3:233/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 45% coverage: 14:251/526 of query aligns to 3:233/242 of 2oljA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
29% identity, 40% coverage: 14:226/526 of query aligns to 3:218/229 of 6z67B
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
29% identity, 40% coverage: 14:226/526 of query aligns to 3:218/230 of 6z4wA
1g291 Malk (see paper)
30% identity, 43% coverage: 17:244/526 of query aligns to 6:236/372 of 1g291
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
30% identity, 40% coverage: 15:225/526 of query aligns to 7:221/375 of 2d62A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 41% coverage: 14:228/526 of query aligns to 1:222/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
29% identity, 41% coverage: 14:228/526 of query aligns to 2:223/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
29% identity, 41% coverage: 14:228/526 of query aligns to 2:223/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
29% identity, 41% coverage: 14:228/526 of query aligns to 2:223/344 of 3tuiC
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
33% identity, 39% coverage: 23:225/526 of query aligns to 11:215/219 of 8w6iD
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
33% identity, 39% coverage: 23:225/526 of query aligns to 11:215/222 of P0A9R7
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
33% identity, 39% coverage: 23:225/526 of query aligns to 11:215/218 of 8hd0A
>H281DRAFT_02965 FitnessBrowser__Burk376:H281DRAFT_02965
MSGLAAAAARAEPILSLTDIGKHFGSFTALEGVSLDLMPGDVHCLLGENGAGKSTLCNVI
FGVHQPDAGAMHVNGTPYRPKNPREALAHGIAMVHQHFSLVDDASVLDNLLLGQARGWLN
RQREAARLREVLESVGLTLQLDAKVADLSVGERQRIEIVKCLMREPRLLLLDEPTAVLLP
AEIDALLDTCERVAKRGCAVVLVTHKLKEICRIATHATVLQSGRVVARSAAPSAEIDRLV
HAMIHRPDHERGETDDDMASRLSLAESRSPYSRPLTEEVLQIDGLSARDAEGVTRLEHCT
LVVNRGEIVGIAGVEGNGQSELGAVLAGMASASAGRFFVAGRDMTHASPRELTQAGVGIV
PEDRHAVGCVTGMSVADNLLLNHLDRYTRAGFLRRRAMRAAALDLMQRFDVRASGPDALF
GGLSGGNQQKAVLARELTLDPLLFLLAAQPTRGLDVGAVAAVYSHIRAARDRGVGVLLIS
SELDELMSVADRIVVLYRGRIMGTCTPEASNRGRIGAWMAGAGEPS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory