SitesBLAST
Comparing H281DRAFT_03007 FitnessBrowser__Burk376:H281DRAFT_03007 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7pt1A Actinobacterial 2-hydroxyacyl-coa lyase (achacl) structure in complex with substrate 2-hib-coa and inactive cofactor 3-deaza-thdp (see paper)
36% identity, 88% coverage: 36:554/587 of query aligns to 10:527/574 of 7pt1A
- binding S-{(3R,5R,9R)-1-[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]-3,5,9-trihydroxy-8,8-dimethyl-3,5-dioxido-10,14-dioxo-2,4,6-trioxa-11,15-diaza-3lambda~5~,5lambda~5~-diphosphaheptadecan-17-yl} 2-hydroxy-2-methylpropanethioate: L113 (= L139), Q114 (= Q140), G256 (≠ D282), S257 (≠ R283), R259 (= R285), S260 (= S286), Q279 (≠ R305), Y352 (≠ L383), R403 (≠ A425), L404 (≠ Q426), G419 (= G443)
- binding magnesium ion: D446 (= D470), N473 (= N497), A475 (= A499)
- binding 2-{4-[(4-amino-2-methylpyrimidin-5-yl)methyl]-3-methylthiophen-2-yl}ethyl trihydrogen diphosphate: E51 (= E77), T74 (= T100), P77 (= P103), G396 (= G418), D397 (= D419), L398 (≠ V420), G419 (= G443), L421 (= L445), G445 (= G469), D446 (= D470), G447 (= G471), A448 (≠ S472), N473 (= N497), A475 (= A499), W476 (≠ M500), N477 (= N501), I478 (≠ Q502), E479 (≠ I503)
Sites not aligning to the query:
- binding S-{(3R,5R,9R)-1-[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]-3,5,9-trihydroxy-8,8-dimethyl-3,5-dioxido-10,14-dioxo-2,4,6-trioxa-11,15-diaza-3lambda~5~,5lambda~5~-diphosphaheptadecan-17-yl} 2-hydroxy-2-methylpropanethioate: 547, 552
P0DUV9 2-hydroxyacyl-CoA lyase; AcHACL; HACL; 2-hydroxyisobutyryl-CoA lyase; EC 4.1.-.- from Actinomycetospora chiangmaiensis (strain DSM 45062 / JCM 15998 / CCTCC AA 205017 / NBRC 104400 / YIM 0006) (see paper)
36% identity, 88% coverage: 36:554/587 of query aligns to 24:541/590 of P0DUV9
- G43 (= G55) binding
- Q255 (vs. gap) binding
- RS 273:274 (= RS 285:286) binding
- R362 (≠ A379) binding
- GDL 410:412 (≠ GDV 418:420) binding
- R417 (≠ A425) binding
- G433 (= G443) binding
- D460 (= D470) binding
- GA 461:462 (≠ GS 471:472) binding
- N487 (= N497) binding
- NRAWNI 487:492 (≠ NSAMNQ 497:502) binding
- A489 (= A499) binding
- E493 (≠ I503) mutation to A: 10-fold decrease of 2-HIB-CoA cleavage rate, 6-fold increase in KM.; mutation to K: No cleavage of 2-HIB-CoA.; mutation to Q: 50-fold decrease of 2-HIB-CoA cleavage rate, 1.5-fold increase in KM.
Sites not aligning to the query:
- 561:564 binding
- 566:590 C-terminal lid
7pt4B Actinobacterial 2-hydroxyacyl-coa lyase (achacl) structure in complex with a covalently bound reaction intermediate as well as products formyl-coa and acetone (see paper)
36% identity, 88% coverage: 36:554/587 of query aligns to 10:527/584 of 7pt4B
- binding magnesium ion: D446 (= D470), N473 (= N497), A475 (= A499)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-{(1r,11r,15s,17r)-19-[(2r,3s,4r,5r)-5-(6-amino-9h-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]-1,11,15,17-tetrahydroxy-12,12-dimethyl-15,17-dioxido-6,10-dioxo-14,16,18-trioxa-2-thia-5,9-diaza-15,17-diphosphanonadec-1-yl}-5-(2-{[(r)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: S257 (≠ R283), R259 (= R285), S260 (= S286), Q279 (≠ R305), Y352 (≠ L383), G395 (= G417), G396 (= G418), D397 (= D419), L398 (≠ V420), L399 (≠ V421), R403 (≠ A425), L404 (≠ Q426), G419 (= G443), L421 (= L445), G445 (= G469), D446 (= D470), G447 (= G471), A448 (≠ S472), N473 (= N497), A475 (= A499), W476 (≠ M500), N477 (= N501), I478 (≠ Q502), E479 (≠ I503)
Sites not aligning to the query:
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-{(1r,11r,15s,17r)-19-[(2r,3s,4r,5r)-5-(6-amino-9h-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]-1,11,15,17-tetrahydroxy-12,12-dimethyl-15,17-dioxido-6,10-dioxo-14,16,18-trioxa-2-thia-5,9-diaza-15,17-diphosphanonadec-1-yl}-5-(2-{[(r)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: 547, 561
7pt4A Actinobacterial 2-hydroxyacyl-coa lyase (achacl) structure in complex with a covalently bound reaction intermediate as well as products formyl-coa and acetone (see paper)
36% identity, 88% coverage: 36:554/587 of query aligns to 10:527/580 of 7pt4A
- binding s-{(9r,13s,15r)-17-[(2r,3s,4r,5r)-5-(6-amino-9h-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]-9,13,15-trihydroxy-10,10-dimethyl-13,15-dioxido-4,8-dioxo-12,14,16-trioxa-3,7-diaza-13,15-diphosphaheptadec-1-yl} thioformate : Q241 (vs. gap), G256 (≠ D282), S257 (≠ R283), R259 (= R285), S260 (= S286), Y278 (≠ F304), Q279 (≠ R305), Y352 (≠ L383), R403 (≠ A425), L404 (≠ Q426)
- binding magnesium ion: D446 (= D470), N473 (= N497), A475 (= A499)
- binding thiamine diphosphate: G396 (= G418), D397 (= D419), L398 (≠ V420), G419 (= G443), L421 (= L445), G445 (= G469), D446 (= D470), G447 (= G471), A448 (≠ S472), N473 (= N497), A475 (= A499), W476 (≠ M500), N477 (= N501), I478 (≠ Q502), E479 (≠ I503)
Sites not aligning to the query:
- binding s-{(9r,13s,15r)-17-[(2r,3s,4r,5r)-5-(6-amino-9h-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]-9,13,15-trihydroxy-10,10-dimethyl-13,15-dioxido-4,8-dioxo-12,14,16-trioxa-3,7-diaza-13,15-diphosphaheptadec-1-yl} thioformate : 552
Q9UJ83 2-hydroxyacyl-CoA lyase 1; 2-hydroxyphytanoyl-CoA lyase; 2-HPCL; Phytanoyl-CoA 2-hydroxylase 2; EC 4.1.2.63 from Homo sapiens (Human) (see 2 papers)
26% identity, 94% coverage: 26:574/587 of query aligns to 9:562/578 of Q9UJ83
- D455 (= D470) mutation D->S,R: Does not affect subcellular localization. Abolishes lyase activity. Does not affect subcellular localization, abolishes lyase activity, does not affect oligomerisation and does not bind TTP; when associated with S-456.
- S456 (≠ G471) mutation to R: Does not affect subcellular localization. Abolishes lyase activity. Does not affect subcellular localization, abolishes lyase activity, does not affect oligomerisation and does not bind TTP; when associated with S-455.
Sites not aligning to the query:
- 576:578 Microbody targeting signal
6xn8A Crystal structure of 2-hydroxyacyl coa lyase (hacl) from rhodospirillales bacterium urhd0017
27% identity, 89% coverage: 31:554/587 of query aligns to 4:524/540 of 6xn8A
- active site: V25 (≠ L52), G27 (= G54), F28 (≠ G55), P29 (≠ H56), I30 (= I57), E50 (= E77), V73 (≠ T100), F112 (≠ L139), Q113 (= Q140), E114 (≠ D141), D162 (≠ R189), F277 (= F304), G388 (= G417), G414 (= G443), M416 (≠ L445), D441 (= D470), N468 (= N497), G470 (vs. gap), I471 (vs. gap), P473 (vs. gap), G474 (≠ A499), E477 (≠ Q502)
- binding adenosine-5'-diphosphate: R152 (≠ A179), G211 (= G240), K212 (≠ Q241), S237 (≠ N266), G270 (= G299), R272 (≠ P301), D295 (= D322), I296 (≠ M323), G313 (= G340), D314 (= D341), G315 (≠ P342)
- binding magnesium ion: D441 (= D470), N468 (= N497), G470 (vs. gap)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: E50 (= E77), V73 (≠ T100), P76 (= P103), H80 (≠ N107), Y367 (≠ P396), A389 (≠ G418), G390 (≠ D419), T391 (≠ V420), G414 (= G443), M416 (≠ L445), G440 (= G469), D441 (= D470), S442 (≠ G471), A443 (≠ S472), F446 (≠ M475), N468 (= N497), G470 (vs. gap), I471 (vs. gap), G472 (vs. gap)
3d7kA Crystal structure of benzaldehyde lyase in complex with the inhibitor mbp (see paper)
29% identity, 93% coverage: 30:573/587 of query aligns to 2:547/554 of 3d7kA
- active site: L24 (= L52), G26 (= G54), A27 (≠ G55), H28 (= H56), I29 (= I57), E49 (= E77), T72 (= T100), L111 (= L139), Q112 (= Q140), A113 (vs. gap), G114 (≠ D141), W162 (≠ R189), L255 (≠ R285), T283 (≠ M306), G392 (= G417), G418 (= G443), M420 (≠ L445), D447 (= D470), N474 (= N497), S476 (≠ A499), W477 (≠ M500), A479 (≠ Q502), T480 (≠ I503), F483 (≠ G506), L545 (vs. gap)
- binding calcium ion: D447 (= D470), N474 (= N497), S476 (≠ A499)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-{(S)-hydroxy[(R)-hydroxy(methoxy)phosphoryl]phenylmethyl}-5-(2-{[(R)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: H25 (≠ C53), G26 (= G54), A27 (≠ G55), E49 (= E77), T72 (= T100), Q112 (= Q140), G392 (= G417), A393 (≠ G418), L394 (≠ D419), T395 (≠ V420), G418 (= G443), M420 (≠ L445), G446 (= G469), D447 (= D470), G448 (= G471), S449 (= S472), Y452 (≠ M475), N474 (= N497), S476 (≠ A499), W477 (≠ M500), G478 (≠ N501), A479 (≠ Q502), T480 (≠ I503)
4qq8C Crystal structure of the formolase fls in space group p 43 21 2 (see paper)
29% identity, 93% coverage: 30:573/587 of query aligns to 2:547/569 of 4qq8C
- active site: L24 (= L52), G26 (= G54), I27 (≠ G55), H28 (= H56), I29 (= I57), E49 (= E77), T72 (= T100), L111 (= L139), Q112 (= Q140), A113 (vs. gap), G114 (≠ D141), W162 (≠ R189), L255 (≠ R285), T283 (≠ M306), G392 (= G417), N418 (≠ G443), M420 (≠ L445), D447 (= D470), N474 (= N497), S476 (≠ A499), W477 (≠ M500), W479 (≠ Q502), T480 (≠ I503), F483 (≠ G506), L545 (vs. gap)
- binding magnesium ion: D447 (= D470), N474 (= N497), S476 (≠ A499)
- binding thiamine diphosphate: H25 (≠ C53), E49 (= E77), Q112 (= Q140), G392 (= G417), G393 (= G418), L394 (≠ D419), T395 (≠ V420), N418 (≠ G443), M420 (≠ L445), G446 (= G469), D447 (= D470), G448 (= G471), S449 (= S472), Y452 (≠ M475), N474 (= N497), S476 (≠ A499), W477 (≠ M500), G478 (≠ N501), W479 (≠ Q502), T480 (≠ I503)
7b2eA Quadruple mutant of oxalyl-coa decarboxylase from methylorubrum extorquens with bound tpp and adp (see paper)
27% identity, 93% coverage: 30:573/587 of query aligns to 3:542/548 of 7b2eA
- active site: V25 (≠ L52), G27 (= G54), I28 (≠ G55), P29 (≠ H56), I30 (= I57), E50 (= E77), V73 (≠ T100), Y114 (≠ L139), G115 (≠ Q140), A164 (≠ R189), L281 (≠ M306), G394 (= G417), G420 (= G443), M422 (≠ L445), I476 (≠ M500), R478 (= R504), G479 (≠ Y505), T482 (≠ L508)
- binding adenosine-5'-diphosphate: C92 (≠ E119), R154 (≠ A179), G215 (= G240), K216 (≠ Q241), G217 (≠ Q242), M241 (≠ N266), G274 (= G299), R276 (≠ P301), D301 (= D322), I302 (≠ M323), D320 (= D341), I321 (≠ P342)
- binding magnesium ion: D446 (= D470), N473 (= N497), G475 (≠ A499)
- binding thiamine diphosphate: F371 (≠ P396), C395 (≠ G418), N396 (≠ D419), T397 (≠ V420), G420 (= G443), M422 (≠ L445), G445 (= G469), D446 (= D470), S447 (≠ G471), A448 (≠ S472), F451 (≠ M475), N473 (= N497), G475 (≠ A499), I476 (≠ M500), F477 (≠ I503)
P39994 Putative 2-hydroxyacyl-CoA lyase; Peroxisomal protein 1; EC 4.1.-.- from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 92% coverage: 38:575/587 of query aligns to 10:546/560 of P39994
Sites not aligning to the query:
- 558:560 Peroxisomal target signal 1 (PTS1)
6lpiB Crystal structure of ahas holo-enzyme (see paper)
27% identity, 94% coverage: 32:585/587 of query aligns to 7:538/539 of 6lpiB
- active site: I27 (≠ L52), G29 (= G54), G30 (= G55), S31 (≠ H56), I32 (= I57), E53 (= E77), C76 (≠ T100), F115 (≠ L139), Q116 (= Q140), E117 (≠ D141), K165 (≠ R189), M256 (≠ H279), A283 (vs. gap), V375 (≠ G417), G401 (= G443), M403 (≠ L445), D428 (= D470), N455 (= N497), A457 (= A499), L458 (≠ M500), L460 (≠ Q502), V461 (≠ I503), Q464 (≠ G506)
- binding flavin-adenine dinucleotide: R155 (≠ A179), G212 (= G240), G213 (≠ Q241), G214 (≠ Q242), T236 (≠ N266), L237 (≠ G267), M238 (≠ A268), L254 (vs. gap), M256 (≠ H279), H257 (= H280), G276 (= G299), A277 (≠ T300), R278 (≠ P301), D280 (= D303), R282 (= R305), A283 (vs. gap), D300 (= D322), I301 (≠ M323), D319 (= D341), V320 (≠ P342), M380 (≠ T422), G398 (= G440)
- binding magnesium ion: D428 (= D470), N455 (= N497)
- binding thiamine diphosphate: E53 (= E77), C76 (≠ T100), P79 (= P103), G376 (= G418), Q377 (≠ D419), H378 (≠ V420), G401 (= G443), M403 (≠ L445), G427 (= G469), D428 (= D470), G429 (= G471), S430 (= S472), M433 (= M475), N455 (= N497), A457 (= A499), L458 (≠ M500), G459 (≠ N501), L460 (≠ Q502), V461 (≠ I503)
P0AFI0 Oxalyl-CoA decarboxylase; EC 4.1.1.8 from Escherichia coli (strain K12) (see paper)
24% identity, 95% coverage: 30:587/587 of query aligns to 7:555/564 of P0AFI0
- R158 (≠ A179) binding
- K220 (≠ Q241) binding
- R280 (≠ P301) binding
- D302 (= D322) binding
- I322 (≠ L346) binding
- Y372 (≠ P396) binding
- D447 (= D470) binding
- N474 (= N497) binding
- G476 (≠ A499) binding
- Y478 (≠ N501) binding
2q29A Crystal structure of oxalyl-coa decarboxylase from escherichia coli in complex with acetyl coenzyme a (see paper)
24% identity, 93% coverage: 30:573/587 of query aligns to 3:540/546 of 2q29A
- active site: V25 (≠ L52), G27 (= G54), I28 (≠ G55), P29 (≠ H56), V30 (≠ I57), E50 (= E77), V73 (≠ T100), Y114 (≠ L139), E115 (≠ Q140), E116 (≠ D141), A164 (≠ R189), L281 (≠ M306), G391 (= G417), G417 (= G443), M419 (≠ L445), D443 (= D470), N470 (= N497), G472 (≠ A499), I473 (≠ M500), R475 (≠ Q502), G476 (≠ I503), V479 (≠ G506), P540 (= P573)
- binding acetyl coenzyme *a: A257 (≠ D282), A258 (≠ R283), R260 (= R285), S261 (= S286), N351 (≠ A379), M355 (≠ L383), N400 (≠ Q426)
- binding magnesium ion: D443 (= D470), N470 (= N497), G472 (≠ A499)
- binding thiamine diphosphate: Y368 (≠ P396), A392 (≠ G418), N393 (≠ D419), T394 (≠ V420), M419 (≠ L445), G442 (= G469), D443 (= D470), S444 (≠ G471), A445 (≠ S472), F448 (≠ M475), N470 (= N497), G472 (≠ A499), I473 (≠ M500), Y474 (≠ N501)
1ozfA The crystal structure of klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactors (see paper)
28% identity, 93% coverage: 33:575/587 of query aligns to 7:536/545 of 1ozfA
- active site: I26 (≠ L52), G28 (= G54), A29 (≠ G55), K30 (≠ H56), I31 (= I57), E51 (= E77), T74 (= T100), H113 (≠ L139), Q114 (= Q140), S115 (≠ D141), Q163 (≠ R189), L253 (≠ A288), E280 (≠ R305), M385 (≠ G417), Q411 (≠ G443), M413 (≠ L445), D438 (= D470), D465 (≠ N497), G467 (≠ A499), Y468 (≠ M500), M470 (≠ Q502), V471 (≠ I503), Q474 (≠ G506), Y534 (≠ P573)
- binding magnesium ion: D438 (= D470), D465 (≠ N497), G467 (≠ A499)
- binding phosphate ion: G249 (vs. gap), R250 (= R285), Q257 (vs. gap), R343 (= R366), R394 (≠ Q426), L396 (≠ V428), Y397 (≠ R429)
- binding thiamine diphosphate: G386 (= G418), S387 (≠ D419), F388 (≠ V420), Q411 (≠ G443), M413 (≠ L445), G437 (= G469), D438 (= D470), G439 (= G471), D465 (≠ N497), G467 (≠ A499), Y468 (≠ M500), N469 (= N501), M470 (≠ Q502), V471 (≠ I503), Y534 (≠ P573)
5d6rB Acetolactate synthase from klebsiella pneumoniae in complex with mechanism-based inhibitor
28% identity, 93% coverage: 33:575/587 of query aligns to 7:537/548 of 5d6rB
- active site: I26 (≠ L52), G28 (= G54), A29 (≠ G55), K30 (≠ H56), I31 (= I57), E51 (= E77), T74 (= T100), H113 (≠ L139), Q114 (= Q140), S115 (≠ D141), Q163 (≠ R189), L254 (≠ A288), E281 (≠ R305), M386 (≠ G417), Q412 (≠ G443), M414 (≠ L445), D439 (= D470), D466 (≠ N497), G468 (≠ A499), Y469 (≠ M500), M471 (≠ Q502), V472 (≠ I503), Q475 (≠ G506), Y535 (≠ P573)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-[(Z)-2-fluoro-1-hydroxy-2-phosphonoethenyl]-5-(2-{[(S)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: M386 (≠ G417), G387 (= G418), S388 (≠ D419), Q412 (≠ G443), M414 (≠ L445), D439 (= D470), G440 (= G471), G468 (≠ A499), Y469 (≠ M500), N470 (= N501), M471 (≠ Q502), Y535 (≠ P573)
- binding magnesium ion: R63 (= R89), Q212 (≠ T245), D439 (= D470), D466 (≠ N497), G468 (≠ A499)
2q28A Crystal structure of oxalyl-coa decarboxylase from escherichia coli in complex with adenosine-5`-diphosphate (see paper)
24% identity, 93% coverage: 30:573/587 of query aligns to 3:540/550 of 2q28A
- active site: V25 (≠ L52), G27 (= G54), I28 (≠ G55), P29 (≠ H56), V30 (≠ I57), E50 (= E77), V73 (≠ T100), Y114 (≠ L139), E115 (≠ Q140), E116 (≠ D141), A164 (≠ R189), L281 (≠ M306), G391 (= G417), G417 (= G443), M419 (≠ L445), D443 (= D470), N470 (= N497), G472 (≠ A499), I473 (≠ M500), R475 (≠ Q502), G476 (≠ I503), V479 (≠ G506), P540 (= P573)
- binding adenosine-5'-diphosphate: R154 (≠ A179), G215 (= G240), K216 (≠ Q241), G217 (≠ Q242), M241 (≠ N266), G274 (= G299), R276 (≠ P301), D298 (= D322), I299 (≠ M323), D317 (= D341), I318 (≠ L346)
- binding magnesium ion: D443 (= D470), N470 (= N497), G472 (≠ A499)
- binding thiamine diphosphate: Y368 (≠ P396), G391 (= G417), A392 (≠ G418), N393 (≠ D419), T394 (≠ V420), M419 (≠ L445), G442 (= G469), D443 (= D470), S444 (≠ G471), A445 (≠ S472), F448 (≠ M475), N470 (= N497), G472 (≠ A499), I473 (≠ M500), Y474 (≠ N501)
1ozgA The crystal structure of klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactor and with an unusual intermediate (see paper)
28% identity, 93% coverage: 33:575/587 of query aligns to 8:540/549 of 1ozgA
- active site: I27 (≠ L52), G29 (= G54), A30 (≠ G55), K31 (≠ H56), I32 (= I57), E52 (= E77), T75 (= T100), H114 (≠ L139), Q115 (= Q140), S116 (≠ D141), Q164 (≠ R189), L257 (≠ A288), E284 (≠ R305), M389 (≠ G417), Q415 (≠ G443), M417 (≠ L445), D442 (= D470), D469 (≠ N497), G471 (≠ A499), Y472 (≠ M500), M474 (≠ Q502), V475 (≠ I503), Q478 (≠ G506), Y538 (≠ P573)
- binding 2-hydroxyethyl dihydrothiachrome diphosphate: M389 (≠ G417), G390 (= G418), S391 (≠ D419), F392 (≠ V420), Q415 (≠ G443), M417 (≠ L445), G441 (= G469), D442 (= D470), G443 (= G471), D469 (≠ N497), G471 (≠ A499), Y472 (≠ M500), N473 (= N501), M474 (≠ Q502), V475 (≠ I503), Y538 (≠ P573)
- binding magnesium ion: D442 (= D470), D469 (≠ N497), G471 (≠ A499)
- binding phosphate ion: G253 (vs. gap), R254 (= R285), Q261 (vs. gap), R347 (= R366), R398 (≠ Q426), Y401 (≠ R429)
8i07D Crystal structure of escherichia coli glyoxylate carboligase double mutant in complex with glycolaldehyde
28% identity, 91% coverage: 41:572/587 of query aligns to 15:557/594 of 8i07D
- binding 2-oxidanylethanal: R285 (= R305), I480 (= I503)
- binding flavin-adenine dinucleotide: R155 (≠ A179), P156 (= P180), G212 (= G240), G213 (≠ Q241), G214 (≠ Q242), N217 (≠ T245), T238 (≠ N266), L239 (≠ G267), M240 (≠ A268), V256 (vs. gap), G257 (vs. gap), Q259 (vs. gap), T260 (vs. gap), G279 (= G299), N280 (≠ T300), R281 (≠ P301), R285 (= R305), H286 (vs. gap), D303 (= D322), I304 (≠ M323), Q308 (≠ T327), D322 (= D341), A323 (≠ P342), I399 (≠ T422), G417 (= G440)
- binding magnesium ion: D447 (= D470), F452 (≠ M475), L453 (≠ T476), E455 (≠ F478), N474 (= N497), Y476 (≠ A499)
- binding thiamine diphosphate: V52 (≠ E77), T76 (= T100), G395 (= G418), L396 (≠ D419), S397 (≠ V420), L422 (= L445), G446 (= G469), D447 (= D470), F448 (≠ G471), D449 (≠ S472), N474 (= N497), Y476 (≠ A499), L477 (≠ M500), G478 (≠ N501), L479 (≠ Q502), I480 (= I503)
- binding ubiquinone-1: Q354 (= Q373), R358 (≠ A377), C492 (≠ R515), Q494 (≠ N517)
Sites not aligning to the query:
8i07A Crystal structure of escherichia coli glyoxylate carboligase double mutant in complex with glycolaldehyde
28% identity, 91% coverage: 41:572/587 of query aligns to 15:557/594 of 8i07A
- binding flavin-adenine dinucleotide: R155 (≠ A179), P156 (= P180), G212 (= G240), G213 (≠ Q241), G214 (≠ Q242), N217 (≠ T245), T238 (≠ N266), L239 (≠ G267), M240 (≠ A268), V256 (vs. gap), G257 (vs. gap), Q259 (vs. gap), T260 (vs. gap), G279 (= G299), N280 (≠ T300), R281 (≠ P301), R285 (= R305), H286 (vs. gap), D303 (= D322), I304 (≠ M323), Q308 (≠ T327), D322 (= D341), A323 (≠ P342), I394 (≠ G417), I399 (≠ T422), G417 (= G440)
- binding magnesium ion: D447 (= D470), F452 (≠ M475), L453 (≠ T476), E455 (≠ F478), N474 (= N497), Y476 (≠ A499)
- binding thiamine diphosphate: I394 (≠ G417), G395 (= G418), L396 (≠ D419), S397 (≠ V420), L422 (= L445), G446 (= G469), D447 (= D470), F448 (≠ G471), D449 (≠ S472), N474 (= N497), Y476 (≠ A499), L477 (≠ M500), G478 (≠ N501), L479 (≠ Q502), I480 (= I503)
- binding ubiquinone-1: Q354 (= Q373), C492 (≠ R515), Q494 (≠ N517)
Sites not aligning to the query:
8beoB Crystal structure of e. Coli glyoxylate carboligase mutant i393a with map
28% identity, 91% coverage: 41:572/587 of query aligns to 13:555/592 of 8beoB
- binding methyl hydrogen (s)-acetylphosphonate: C490 (≠ R515), Q492 (≠ N517)
- binding flavin-adenine dinucleotide: R153 (≠ A179), P154 (= P180), G210 (= G240), G211 (≠ Q241), G212 (≠ Q242), N215 (≠ T245), T236 (≠ N266), L237 (≠ G267), M238 (≠ A268), V254 (vs. gap), G255 (vs. gap), Q257 (vs. gap), T258 (vs. gap), G277 (= G299), N278 (≠ T300), R279 (≠ P301), A281 (≠ D303), R283 (= R305), H284 (vs. gap), D301 (= D322), I302 (≠ M323), Q306 (≠ T327), D320 (= D341), A321 (≠ P342), G415 (= G440)
- binding magnesium ion: D445 (= D470), F450 (≠ M475), L451 (≠ T476), E453 (≠ F478), N472 (= N497), Y474 (≠ A499)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-{(1s)-1-hydroxy-1-[(r)-hydroxy(methoxy)phosphoryl]ethyl}-5-(2-{[(s)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: R283 (= R305), G393 (= G418), L394 (≠ D419), S395 (≠ V420), L420 (= L445), G444 (= G469), D445 (= D470), F446 (≠ G471), D447 (≠ S472), N472 (= N497), Y474 (≠ A499), L475 (≠ M500), G476 (≠ N501), L477 (≠ Q502), I478 (= I503)
- binding 2,3-dimethoxy-5-methyl-1,4-benzoquinone: Q352 (= Q373), R356 (≠ A377)
Sites not aligning to the query:
Query Sequence
>H281DRAFT_03007 FitnessBrowser__Burk376:H281DRAFT_03007
MSAVVSSLNPSTASTTAEDTLKQKTRNAGVVSGGHLVAKALKNEGVDTIFTLCGGHIIDI
YDGCVDEGIRIIDVRHEQVAAHAADGYARQTGKLGCVVTTAGPGCTNAVTGIATAFRSES
PILHIGGQGALTQHKMGSLQDLPHVDIMAPITKFAASVSSTERVADMISMAARECFNGAP
GPAYLEIPRDVLDREVDLSRAVVPQPGHYRASTKSIGDPRDIEKLADILVNSERPAILYG
QQVWTARGHEEAIALLRGLDIPGYFNGASRGLLPPGDPHHFDRTRSQAFANADVLIVVGT
PFDFRMGYGKRISKELTLVQIDMDYRTVGKNRDIDLGLVGDPGAILAAVLQAASGRLKDD
KRQARRKWMAQLQDAEATATEKLMPLFKSNSTPIHPYRVAYELNEFLADDTVYIGDGGDV
VTISAQAVRPRRPGQWMDPGALGSLGVGTGFALAAKIAHPQKEVLCYYGDGSFGMTAFDM
ETANRFGAPYLAVIGNNSAMNQIRYGQLAKYGDERGNVGNLLSDVPFSKFAEMLGGHGEE
VRDPAQIAGALQRAREAIHRTGRSAVVNIWVDPREYAPGTKNQTMYK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory