Comparing H281DRAFT_03077 FitnessBrowser__Burk376:H281DRAFT_03077 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
42% identity, 68% coverage: 46:235/279 of query aligns to 41:237/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
42% identity, 68% coverage: 46:235/279 of query aligns to 41:237/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
42% identity, 68% coverage: 46:235/279 of query aligns to 41:237/260 of 7ahdC
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
39% identity, 69% coverage: 44:235/279 of query aligns to 19:217/375 of 2d62A
1g291 Malk (see paper)
40% identity, 69% coverage: 44:235/279 of query aligns to 16:214/372 of 1g291
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
43% identity, 70% coverage: 50:244/279 of query aligns to 36:229/378 of P69874
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
39% identity, 68% coverage: 46:235/279 of query aligns to 21:203/353 of 1vciA
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
37% identity, 75% coverage: 27:235/279 of query aligns to 1:219/232 of 1f3oA
8hplC Lpqy-sugabc in state 1 (see paper)
38% identity, 68% coverage: 46:234/279 of query aligns to 16:205/384 of 8hplC
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
38% identity, 68% coverage: 46:234/279 of query aligns to 18:207/363 of 8hprC
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
38% identity, 68% coverage: 46:234/279 of query aligns to 18:207/362 of 8hprD
Sites not aligning to the query:
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
37% identity, 75% coverage: 27:235/279 of query aligns to 1:219/230 of 1l2tA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
41% identity, 67% coverage: 50:235/279 of query aligns to 20:210/240 of 4ymuJ
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 68% coverage: 46:234/279 of query aligns to 19:208/393 of P9WQI3
7mdyC Lolcde nucleotide-bound
38% identity, 79% coverage: 27:246/279 of query aligns to 2:225/226 of 7mdyC
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
37% identity, 80% coverage: 23:246/279 of query aligns to 1:228/233 of P75957
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
38% identity, 79% coverage: 27:246/279 of query aligns to 4:227/229 of 7v8iD
7arlD Lolcde in complex with lipoprotein and adp (see paper)
39% identity, 71% coverage: 27:224/279 of query aligns to 2:206/222 of 7arlD
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
36% identity, 76% coverage: 44:255/279 of query aligns to 16:229/369 of P19566
Sites not aligning to the query:
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
36% identity, 76% coverage: 44:255/279 of query aligns to 13:226/367 of 1q12A
Sites not aligning to the query:
>H281DRAFT_03077 FitnessBrowser__Burk376:H281DRAFT_03077
MVANPTLLFPDNTERTARSGPAVSEKLLAVENVSLEYRTRERIVRATHDVSFDVFGGDRF
VLLGPSGCGKSTLLKAVGGFIEPASGTISLDGQIVRGPGADRIVVFQEFDQLPPWKTVLQ
NVAFPLRVAKKLSRAEANERALHYLEKVGLAAFANAYPHTLSGGMKQRVAIARALAMQPR
VLLMDEPFAALDALTRRRMQEELLRLWEEVNFTLLFVTHSIEEALVVGNRILLLSPHPGR
VRAELNSHQYSQDSFGRSDFQRSVARIHHLLFDETEAVQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory