Comparing H281DRAFT_03146 FitnessBrowser__Burk376:H281DRAFT_03146 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
28% identity, 84% coverage: 13:259/295 of query aligns to 1:243/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
28% identity, 84% coverage: 13:259/295 of query aligns to 1:243/261 of 3klcA
4iztA The e41q mutant of the amidase from nesterenkonia sp. An1 showing covalent addition of the acetamide moiety of fluoroacetamide at the active site cysteine
31% identity, 79% coverage: 26:259/295 of query aligns to 23:255/263 of 4iztA
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
28% identity, 84% coverage: 13:259/295 of query aligns to 2:244/262 of Q9UYV8
4izuA The e41q mutant of the amidase from nesterenkonia sp. An1 showing the result of michael addition of acrylamide at the active site cysteine
32% identity, 73% coverage: 26:241/295 of query aligns to 15:229/254 of 4izuA
5nybA A c145a mutant of nesterenkonia an1 amidase bound to adipamide
31% identity, 79% coverage: 26:259/295 of query aligns to 22:254/262 of 5nybA
5ny7A A c145a mutant of nesterenkonia an1 amidase bound to nicotinamide
31% identity, 79% coverage: 26:259/295 of query aligns to 22:254/262 of 5ny7A
Sites not aligning to the query:
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
25% identity, 86% coverage: 8:261/295 of query aligns to 6:257/276 of Q9NQR4
5nycA A c145a mutant of nesterenkonia an1 amidase bound to propionitrile
32% identity, 73% coverage: 26:241/295 of query aligns to 22:236/261 of 5nycA
4izsA The c145a mutant of the amidase from nesterenkonia sp. An1 in complex with butyramide
32% identity, 73% coverage: 26:241/295 of query aligns to 22:236/261 of 4izsA
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
26% identity, 79% coverage: 13:245/295 of query aligns to 9:237/269 of 6ypaB
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
26% identity, 79% coverage: 13:245/295 of query aligns to 3:231/263 of 7ovgA
Q03217 Aliphatic nitrilase; EC 3.5.5.7 from Rhodococcus rhodochrous (see paper)
32% identity, 43% coverage: 13:139/295 of query aligns to 8:145/366 of Q03217
Sites not aligning to the query:
Q94JV5 Deaminated glutathione amidase, chloroplastic/cytosolic; dGSH amidase; Nitrilase-like protein 2; Protein nitrilase 1 homolog; AtNit1; Protein Nit1 homolog; EC 3.5.1.128 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
24% identity, 87% coverage: 5:261/295 of query aligns to 29:295/307 of Q94JV5
Sites not aligning to the query:
Q02068 Aliphatic nitrilase; EC 3.5.5.7 from Rhodococcus rhodochrous (see paper)
24% identity, 68% coverage: 13:213/295 of query aligns to 13:233/383 of Q02068
P11436 Aliphatic amidase; Acylamide amidohydrolase; EC 3.5.1.4 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
27% identity, 75% coverage: 45:264/295 of query aligns to 51:272/346 of P11436
P47016 Deaminated glutathione amidase; dGSH amidase; Nitrilase homolog 1; EC 3.5.1.128 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
22% identity, 84% coverage: 14:261/295 of query aligns to 7:294/307 of P47016
4hg5A Structural insights into yeast nit2: wild-type yeast nit2 in complex with oxaloacetate (see paper)
22% identity, 84% coverage: 14:261/295 of query aligns to 4:291/304 of 4hg5A
4hg3A Structural insights into yeast nit2: wild-type yeast nit2 in complex with alpha-ketoglutarate (see paper)
22% identity, 84% coverage: 14:261/295 of query aligns to 4:291/304 of 4hg3A
P46011 Bifunctional nitrilase/nitrile hydratase NIT4; Cyanoalanine nitrilase; Nitrilase 4; EC 3.5.5.1; EC 3.5.5.4; EC 4.2.1.65 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
23% identity, 88% coverage: 19:277/295 of query aligns to 42:329/355 of P46011
>H281DRAFT_03146 FitnessBrowser__Burk376:H281DRAFT_03146
VNNKLASLPRVPLQIAAAQAQPVCGDVTANIAKTVELTGRAADRGARLVVFPEKFLSGYE
PGLIAGDPSEYAFGQSDSRLDPIREACRRHAIAAIVGAATRDAGELHISSLVFDRRGEDV
EPYHKQYLYKSEAEIYRAGMRGCMLELDGWRLALGVCYDSGFPEHARHAAVNGAHAYLVS
GLFSVKSGYHQSRIWFPARAFDNTMYVLLSNHIGTTGGWDTCGASAIWSPYGDVIAEAGR
EREEVISALLDPAVLADVRKRETALADFAAHVDAPELDHAIRRIDRRHAAVVALE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory