SitesBLAST
Comparing H281DRAFT_03160 FitnessBrowser__Burk376:H281DRAFT_03160 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
30% identity, 54% coverage: 191:412/413 of query aligns to 138:363/364 of 3if9A
- binding flavin-adenine dinucleotide: P173 (≠ G224), V174 (≠ D225), S202 (≠ L251), G203 (= G252), W205 (= W254), F209 (≠ L258), G300 (= G350), R302 (= R352), H327 (= H377), F328 (≠ A378), R329 (≠ H379), N330 (≠ H380), G331 (= G381), I332 (≠ L382)
- binding glycolic acid: Y246 (≠ L298), R302 (= R352), R329 (≠ H379)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
30% identity, 54% coverage: 191:412/413 of query aligns to 138:363/369 of O31616
- V174 (≠ D225) binding
- H244 (≠ G296) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (= R352) binding
- 327:333 (vs. 377:383, 29% identical) binding
- R329 (≠ H379) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
25% identity, 99% coverage: 7:413/413 of query aligns to 26:383/383 of 5i39A
- active site: F66 (≠ Y81), Q69 (≠ D84), A70 (= A85), Q248 (≠ K271), P267 (= P289)
- binding flavin-adenine dinucleotide: V30 (≠ L11), G31 (= G12), G33 (= G14), I34 (= I15), L35 (≠ V16), V53 (= V34), E54 (≠ D35), K55 (≠ R36), Q62 (≠ E42), S63 (≠ T43), F66 (≠ Y81), Y67 (≠ H82), Q69 (≠ D84), A196 (= A226), A197 (≠ R230), G226 (≠ L251), G227 (= G252), W229 (= W254), Q248 (≠ K271), Q250 (≠ G273), G321 (= G350), M323 (≠ R352), T348 (≠ H377), G349 (≠ A378), W350 (≠ H379), G351 (= G381), M352 (≠ L382), T353 (= T383)
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
30% identity, 54% coverage: 191:412/413 of query aligns to 138:363/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (≠ L298), R302 (= R352), R329 (≠ H379)
- binding flavin-adenine dinucleotide: V174 (≠ D225), S202 (≠ L251), G203 (= G252), W205 (= W254), F209 (≠ L258), G300 (= G350), R302 (= R352), H327 (= H377), R329 (≠ H379), N330 (≠ H380), G331 (= G381), I332 (≠ L382)
- binding phosphate ion: R254 (= R307)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49
- binding phosphate ion: 89
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
29% identity, 55% coverage: 170:398/413 of query aligns to 118:348/369 of S5FMM4
- S202 (≠ L251) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ L382) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ I392) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
23% identity, 96% coverage: 5:400/413 of query aligns to 1:348/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (≠ L11), G8 (= G12), G10 (= G14), V11 (≠ I15), I12 (≠ V16), V30 (= V34), E31 (≠ D35), K32 (≠ R36), E38 (= E42), A39 (≠ T43), S40 (= S44), A43 (≠ N47), G45 (= G49), L46 (= L68), V171 (vs. gap), G200 (≠ L251), G201 (= G252), W203 (= W254), G298 (= G350), R300 (= R352), P301 (= P353), Y326 (≠ A378), R327 (≠ H379), N328 (≠ H380), G329 (= G381), I330 (≠ L382)
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
27% identity, 70% coverage: 125:412/413 of query aligns to 78:367/370 of 4yshA
- active site: I262 (≠ T310), L283 (≠ T335), G305 (= G350), N335 (≠ H380), L338 (≠ T383)
- binding flavin-adenine dinucleotide: V178 (≠ T216), S206 (≠ L251), G207 (= G252), W209 (= W254), R307 (= R352), H332 (= H377), R334 (≠ H379), N335 (≠ H380), G336 (= G381), I337 (≠ L382)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
27% identity, 70% coverage: 125:412/413 of query aligns to 78:367/368 of 4yshB
- active site: I262 (≠ T310), L283 (≠ T335), G305 (= G350), N335 (≠ H380), L338 (≠ T383)
- binding flavin-adenine dinucleotide: V178 (≠ T216), S206 (≠ L251), W209 (= W254), R307 (= R352), H332 (= H377), R334 (≠ H379), N335 (≠ H380), G336 (= G381), I337 (≠ L382), L338 (≠ T383)
- binding glycine: G249 (= G296), Y251 (≠ L298), Y251 (≠ L298), A264 (= A312), R307 (= R352), R334 (≠ H379), R334 (≠ H379)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
30% identity, 46% coverage: 225:412/413 of query aligns to 182:369/377 of Q5L2C2
- R309 (= R352) binding
- 334:340 (vs. 377:383, 29% identical) binding
- R336 (≠ H379) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 180 binding
6j39A Crystal structure of cmis2 with inhibitor (see paper)
27% identity, 73% coverage: 111:413/413 of query aligns to 54:368/368 of 6j39A
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: R243 (≠ P289), Y252 (≠ L298), Y267 (≠ I314), R308 (= R352), R334 (≠ H379), I335 (≠ H380)
- binding flavin-adenine dinucleotide: A174 (vs. gap), A203 (≠ L251), W206 (= W254), I228 (≠ H275), Y252 (≠ L298), R308 (= R352), S333 (≠ A378), R334 (≠ H379), I335 (≠ H380), G336 (= G381), V337 (≠ L382), Q338 (≠ T383)
Sites not aligning to the query:
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: 44, 46, 49
- binding flavin-adenine dinucleotide: 7, 9, 10, 11, 29, 30, 31, 32, 36, 37, 38, 40, 41, 42, 43, 44
6j38A Crystal structure of cmis2 (see paper)
27% identity, 73% coverage: 111:413/413 of query aligns to 54:368/368 of 6j38A
- binding flavin-adenine dinucleotide: A174 (vs. gap), A203 (≠ L251), W206 (= W254), G226 (= G273), G306 (= G350), R308 (= R352), S333 (≠ A378), R334 (≠ H379), I335 (≠ H380), G336 (= G381), V337 (≠ L382), Q338 (≠ T383)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 9, 11, 29, 30, 31, 36, 37, 38, 41, 42, 43, 44
5fjnA Structure of l-amino acid deaminase from proteus myxofaciens in complex with anthranilate (see paper)
23% identity, 99% coverage: 7:413/413 of query aligns to 30:445/447 of 5fjnA
- active site: S67 (≠ T43), Y71 (≠ N47), S72 (≠ A48), L252 (= L268)
- binding 2-aminobenzoic acid: L252 (= L268), R289 (vs. gap), V411 (≠ A378), W412 (≠ H380)
- binding flavin-adenine dinucleotide: I34 (≠ L11), G35 (= G12), G37 (= G14), I38 (= I15), Q39 (≠ V16), L57 (≠ V34), E58 (≠ D35), K59 (≠ R36), E65 (≠ N41), Q66 (≠ E42), S67 (≠ T43), A70 (≠ G46), Y71 (≠ N47), S72 (≠ A48), Q73 (≠ G49), V201 (vs. gap), G230 (≠ L251), G231 (= G252), W233 (= W254), L252 (= L268), Q254 (≠ V270), F343 (vs. gap), V385 (≠ R352), T410 (≠ H377), V411 (≠ A378), W412 (≠ H380), G413 (= G381), M414 (≠ L382), T415 (= T383)
5fjmA Structure of l-amino acid deaminase from proteus myxofaciens (see paper)
23% identity, 99% coverage: 7:413/413 of query aligns to 30:445/447 of 5fjmA
- active site: S67 (≠ T43), Y71 (≠ N47), S72 (≠ A48), L252 (= L268)
- binding flavin-adenine dinucleotide: I34 (≠ L11), G35 (= G12), G37 (= G14), I38 (= I15), Q39 (≠ V16), L57 (≠ V34), E58 (≠ D35), K59 (≠ R36), E65 (≠ N41), Q66 (≠ E42), S67 (≠ T43), A70 (≠ G46), Y71 (≠ N47), S72 (≠ A48), Q73 (≠ G49), V201 (vs. gap), G230 (≠ L251), G231 (= G252), W233 (= W254), L252 (= L268), Q254 (≠ V270), F343 (vs. gap), V385 (≠ R352), T410 (≠ H377), V411 (≠ A378), W412 (≠ H380), G413 (= G381), M414 (≠ L382), T415 (= T383)
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
22% identity, 61% coverage: 162:412/413 of query aligns to 106:370/374 of 1y56B
- active site: H224 (= H275), P239 (≠ H288), G305 (= G350), M338 (≠ T383)
- binding flavin-adenine dinucleotide: E170 (vs. gap), V171 (vs. gap), T200 (≠ L251), N201 (≠ G252), W203 (= W254), G305 (= G350), Y306 (≠ A351), Y307 (≠ R352), G334 (≠ H379), H335 (= H380), G336 (= G381), F337 (≠ L382), M338 (≠ T383)
- binding flavin mononucleotide: I260 (≠ G311), R301 (≠ Q346), W303 (= W348)
Sites not aligning to the query:
- active site: 44, 47, 48
- binding flavin-adenine dinucleotide: 11, 13, 14, 15, 33, 34, 35, 42, 43, 45, 46, 47, 49
- binding flavin mononucleotide: 44, 45
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
22% identity, 98% coverage: 8:413/413 of query aligns to 28:400/824 of Q8GAI3
- W66 (≠ F45) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (≠ G46) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
5hxwA L-amino acid deaminase from proteus vulgaris (see paper)
31% identity, 23% coverage: 320:413/413 of query aligns to 341:433/433 of 5hxwA
- binding cetyl-trimethyl-ammonium: M373 (≠ R352), E379 (≠ M358), G399 (≠ A378), W400 (≠ H379)
- binding flavin-adenine dinucleotide: G371 (= G350), M373 (≠ R352), T398 (≠ H377), G399 (≠ A378), W400 (≠ H379), G401 (= G381), M402 (≠ L382), T403 (= T383)
Sites not aligning to the query:
- active site: 58, 61, 62, 240, 284, 288
- binding cetyl-trimethyl-ammonium: 291, 294, 310, 311, 317, 318, 320
- binding flavin-adenine dinucleotide: 22, 23, 25, 26, 27, 46, 47, 53, 54, 55, 57, 58, 59, 60, 61, 188, 189, 218, 219, 221, 240, 242, 331
7rdfA Crystal structure of pseudomonas aeruginosa d-arginine dehydrogenase y249f co-crystallized in the presence of d-arginine (see paper)
23% identity, 58% coverage: 159:396/413 of query aligns to 97:349/375 of 7rdfA
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{S})-5-[5-[(~{E})-4-carbamimidamidobut-2-enoyl]-7,8-dimethyl-2,4-bis(oxidanylidene)-1~{H}-benzo[g]pteridin-10-yl]-2,3,4-tris(oxidanyl)pentyl] hydrogen phosphate: E170 (vs. gap), A171 (vs. gap), A199 (≠ L251), G200 (= G252), W202 (= W254), R222 (≠ G273), F249 (≠ L298), G303 (= G350), R305 (= R352), Q330 (≠ H377), G331 (≠ A378), G332 (≠ H379), Y333 (≠ H380), G334 (= G381), I335 (≠ L382), Q336 (≠ T383)
- binding 6-hydroxy-flavin-adenine dinucleotide: E170 (vs. gap), A171 (vs. gap), A199 (≠ L251), G200 (= G252), W202 (= W254), R222 (≠ G273), G303 (= G350), R305 (= R352), Q330 (≠ H377), G331 (≠ A378), G332 (≠ H379), Y333 (≠ H380), G334 (= G381), I335 (≠ L382), Q336 (≠ T383)
Sites not aligning to the query:
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{S})-5-[5-[(~{E})-4-carbamimidamidobut-2-enoyl]-7,8-dimethyl-2,4-bis(oxidanylidene)-1~{H}-benzo[g]pteridin-10-yl]-2,3,4-tris(oxidanyl)pentyl] hydrogen phosphate: 9, 10, 12, 13, 14, 31, 32, 33, 40, 41, 42, 44, 45, 46, 48, 53, 87
- binding 6-hydroxy-flavin-adenine dinucleotide: 9, 10, 12, 13, 14, 32, 33, 40, 41, 42, 45, 46, 48
6pldA Crystal structure of pseudomonas aeruginosa d-arginine dehydrogenase y249f variant with 6-oh-fad - green fraction (see paper)
23% identity, 58% coverage: 159:396/413 of query aligns to 97:349/375 of 6pldA
- binding 6-hydroxy-flavin-adenine dinucleotide: E170 (vs. gap), A171 (vs. gap), A199 (≠ L251), G200 (= G252), W202 (= W254), G303 (= G350), R305 (= R352), Q330 (≠ H377), G331 (≠ A378), G332 (≠ H379), Y333 (≠ H380), G334 (= G381), I335 (≠ L382), Q336 (≠ T383)
Sites not aligning to the query:
- binding 6-hydroxy-flavin-adenine dinucleotide: 9, 10, 12, 13, 14, 31, 32, 33, 40, 41, 42, 44, 45, 46, 48
6p9dA Crystal structure of pseudomonas aeruginosa d-arginine dehydrogenase y249f variant with fad - yellow fraction (see paper)
23% identity, 58% coverage: 159:396/413 of query aligns to 97:349/375 of 6p9dA
- binding dihydroflavine-adenine dinucleotide: E170 (vs. gap), A171 (vs. gap), A199 (≠ L251), G200 (= G252), W202 (= W254), G303 (= G350), R305 (= R352), Q330 (≠ H377), G331 (≠ A378), G332 (≠ H379), Y333 (≠ H380), G334 (= G381), I335 (≠ L382), Q336 (≠ T383)
Sites not aligning to the query:
- binding dihydroflavine-adenine dinucleotide: 9, 10, 12, 13, 14, 32, 33, 40, 41, 42, 44, 45, 46, 47, 48
3sm8A Crystal structure of pseudomonas aeruginosa d-arginine dehydrogenase in complex with an (n5) flavin adduct (see paper)
23% identity, 58% coverage: 159:396/413 of query aligns to 103:355/381 of 3sm8A
- binding [(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl (2R,3S,4S)-5-[7,8-dimethyl-5-(3-methylbutanoyl)-2,4-dioxo-1,3,4,5-tetrahydrobenzo[g]pteridin-10(2H)-yl]-2,3,4-trihydroxypentyl dihydrogen diphosphate: E176 (vs. gap), A177 (vs. gap), A205 (≠ L251), G206 (= G252), W208 (= W254), I212 (≠ L258), R228 (≠ G273), M246 (≠ L298), Y255 (≠ R307), G309 (= G350), R311 (= R352), Q336 (≠ H377), G337 (≠ A378), G338 (≠ H379), Y339 (≠ H380), G340 (= G381), I341 (≠ L382), Q342 (≠ T383)
Sites not aligning to the query:
- binding [(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl (2R,3S,4S)-5-[7,8-dimethyl-5-(3-methylbutanoyl)-2,4-dioxo-1,3,4,5-tetrahydrobenzo[g]pteridin-10(2H)-yl]-2,3,4-trihydroxypentyl dihydrogen diphosphate: 15, 16, 18, 19, 20, 37, 38, 39, 46, 47, 48, 50, 51, 52, 54, 59
Query Sequence
>H281DRAFT_03160 FitnessBrowser__Burk376:H281DRAFT_03160
MTAIKFDTVVLGAGIVGVCVAVHLQQRGRQVALVDRKLPGNETSFGNAGLIQREGVYPYA
FPRGLGALLRYARNQSLDVRYHGDALFHAAPFLWRYWRNSEPAKHAAIAKSYSTLIEHCI
SEHRELAANAGASALLRPTGWIKVFRSNAAQDAEIRLAEQWRREYGVEFETLDAARLQQA
EPDLDKALQGGLRYTQADSVSDPNALVTAYAKYFETLGGRIFTGDANTLRNGWEVTTDAG
TIAASSVVVALGPWSDVLTSRLGYSLPLGVKRGYHMHYSPRAGARLNHPVLDVENGYLLA
PMARGIRLTTGAEIALRDAPKTPTQLAAVEPIARTLFPLDQRVDDQPWMGARPCTPDMMP
VIGRAGKHQGLWFAFGHAHHGLTLGPVTGRLIAEMMTGEQTLVDPRPFRVDRF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory