SitesBLAST
Comparing H281DRAFT_03275 FitnessBrowser__Burk376:H281DRAFT_03275 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4cpdA Alcohol dehydrogenase tadh from thermus sp. Atn1
35% identity, 99% coverage: 1:387/389 of query aligns to 1:343/346 of 4cpdA
- active site: C38 (= C38), G39 (= G39), S40 (= S40), H43 (= H43), H59 (= H60), E60 (= E61), C89 (= C90), C92 (= C93), C95 (= C96), C103 (= C104), G107 (= G124), D152 (= D169), T156 (= T173), K340 (= K384)
- binding nicotinamide-adenine-dinucleotide: G39 (= G39), S40 (= S40), T156 (= T173), G178 (= G195), P179 (= P196), V180 (= V197), D200 (= D217), R201 (≠ Y218), R205 (= R222), A243 (= A260), V244 (= V261), V266 (≠ P308), V268 (= V310), L292 (≠ Q334), A293 (≠ T335), F333 (= F375)
- binding zinc ion: C38 (= C38), H59 (= H60), C89 (= C90), C92 (= C93), C95 (= C96), C103 (= C104), D152 (= D169)
Q52078 Formaldehyde dismutase; EC 1.2.98.1 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
34% identity, 96% coverage: 2:375/389 of query aligns to 5:380/399 of Q52078
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2:399 modified: mature protein, Formaldehyde dismutase
2dphA Crystal structure of formaldehyde dismutase
34% identity, 96% coverage: 2:375/389 of query aligns to 4:379/398 of 2dphA
- active site: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), H66 (= H60), E67 (= E61), C96 (= C90), C99 (= C93), C102 (= C96), C110 (= C104), L114 (≠ N108), S168 (≠ G168), D169 (= D169), P172 (= P172)
- binding nicotinamide-adenine-dinucleotide: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), F92 (= F86), D169 (= D169), T173 (= T173), A192 (≠ W192), G193 (= G193), G195 (= G195), P196 (= P196), V197 (= V197), G216 (≠ I216), D217 (= D217), Q218 (≠ Y218), R222 (= R222), L236 (≠ F236), V262 (= V261), H267 (= H266), P298 (= P308), G299 (= G309), I300 (≠ V310), A337 (≠ T335)
- binding zinc ion: C45 (= C38), H66 (= H60), C96 (= C90), C99 (= C93), C102 (= C96), C110 (= C104), D169 (= D169)
Sites not aligning to the query:
4jlwA Crystal structure of formaldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
32% identity, 96% coverage: 2:375/389 of query aligns to 3:378/395 of 4jlwA
- binding nicotinamide-adenine-dinucleotide: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), D168 (= D169), T172 (= T173), G194 (= G195), P195 (= P196), V196 (= V197), D216 (= D217), R221 (= R222), V261 (= V261), R266 (≠ H266), H268 (≠ T268), V281 (= V291), P298 (= P308), L300 (≠ V310), Q336 (= Q334), T337 (= T335)
- binding zinc ion: C45 (= C38), H66 (= H60), C96 (= C90), C99 (= C93), C102 (= C96), C110 (= C104), D168 (= D169)
1kolA Crystal structure of formaldehyde dehydrogenase (see paper)
33% identity, 96% coverage: 2:375/389 of query aligns to 3:378/396 of 1kolA
- active site: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), H66 (= H60), E67 (= E61), C96 (= C90), C99 (= C93), C102 (= C96), C110 (= C104), N114 (= N108), D168 (= D169), T172 (= T173)
- binding nicotinamide-adenine-dinucleotide: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), F92 (= F86), D168 (= D169), T172 (= T173), G192 (= G193), G194 (= G195), P195 (= P196), V196 (= V197), D216 (= D217), L217 (≠ Y218), R221 (= R222), A260 (= A260), V261 (= V261), R266 (≠ H266), H268 (≠ T268), V281 (= V291), P298 (= P308), L300 (≠ V310), Q336 (= Q334), T337 (= T335)
- binding zinc ion: C45 (= C38), H66 (= H60), C96 (= C90), C99 (= C93), C102 (= C96), C110 (= C104), D168 (= D169)
Sites not aligning to the query:
P46154 Glutathione-independent formaldehyde dehydrogenase; FALDH; FDH; Formaldehyde dismutase; EC 1.2.1.46; EC 1.2.98.1 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
33% identity, 96% coverage: 2:375/389 of query aligns to 5:380/399 of P46154
5ylnA Zinc dependent alcohol dehydrogenase 2 from streptococcus pneumonia - apo form
29% identity, 96% coverage: 17:388/389 of query aligns to 21:342/348 of 5ylnA
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
28% identity, 94% coverage: 11:376/389 of query aligns to 13:344/357 of 7y9pA
7uutA Ternary complex crystal structure of secondary alcohol dehydrogenases from the thermoanaerobacter ethanolicus mutants c295a and i86a provides better understanding of catalytic mechanism (see paper)
28% identity, 93% coverage: 25:387/389 of query aligns to 24:349/352 of 7uutA
- binding (2R)-pentan-2-ol: S39 (= S40), H59 (= H60), A85 (≠ F86), W110 (≠ K116), D150 (= D169), C295 (≠ W330)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C37 (= C38), T38 (≠ G39), S39 (= S40), D150 (= D169), T154 (= T173), G174 (= G193), G176 (= G195), P177 (= P196), V178 (= V197), S199 (≠ Y218), R200 (≠ V219), A242 (= A260), G243 (≠ V261), G244 (= G262), I248 (≠ V291), V265 (≠ P308), N266 (≠ G309), Y267 (≠ V310), C295 (≠ W330), K340 (= K378)
- binding zinc ion: C37 (= C38), H59 (= H60), D150 (= D169)
7ux4A Crystallographic snapshots of ternary complexes of thermophilic secondary alcohol dehydrogenase from thermoanaerobacter pseudoethanolicus reveal the dynamics of ligand exchange and the proton relay network. (see paper)
28% identity, 93% coverage: 25:387/389 of query aligns to 22:347/350 of 7ux4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D148 (= D169), T152 (= T173), G172 (= G193), I173 (≠ A194), G174 (= G195), P175 (= P196), V176 (= V197), R198 (≠ V219), G242 (= G262), V263 (≠ P308), N264 (≠ G309), Y265 (≠ V310), C293 (≠ W330)
- binding (1S,3S)-3-methylcyclohexan-1-ol: S37 (= S40), H57 (= H60), W108 (≠ K116), D148 (= D169)
- binding zinc ion: C35 (= C38), H57 (= H60), E58 (= E61), D148 (= D169)
1ykfA NADP-dependent alcohol dehydrogenase from thermoanaerobium brockii (see paper)
28% identity, 93% coverage: 25:387/389 of query aligns to 24:349/352 of 1ykfA
- active site: C37 (= C38), T38 (≠ G39), S39 (= S40), H42 (= H43), H59 (= H60), E60 (= E61), D89 (≠ C90), T92 (≠ C93), V95 (≠ C96), S103 (≠ R109), D150 (= D169), T154 (= T173), K346 (= K384)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S39 (= S40), D150 (= D169), T154 (= T173), G174 (= G193), I175 (≠ A194), G176 (= G195), P177 (= P196), V178 (= V197), S199 (≠ Y218), R200 (≠ V219), Y218 (≠ F236), I223 (≠ V241), N266 (≠ G309), Y267 (≠ V310)
- binding zinc ion: C37 (= C38), H59 (= H60), D150 (= D169)
1bxzB Crystal structure of a thermophilic alcohol dehydrogenase substrate complex from thermoanaerobacter brockii (see paper)
28% identity, 93% coverage: 25:387/389 of query aligns to 24:349/352 of 1bxzB
- active site: C37 (= C38), T38 (≠ G39), S39 (= S40), H42 (= H43), H59 (= H60), E60 (= E61), D89 (≠ C90), T92 (≠ C93), V95 (≠ C96), S103 (≠ R109), D150 (= D169), T154 (= T173), K346 (= K384)
- binding 2-butanol: H59 (= H60), D150 (= D169)
P14941 NADP-dependent isopropanol dehydrogenase; EC 1.1.1.80 from Thermoanaerobacter brockii (Thermoanaerobium brockii) (see 2 papers)
28% identity, 93% coverage: 25:387/389 of query aligns to 24:349/352 of P14941
7xy9A Cryo-em structure of secondary alcohol dehydrogenases tbsadh after carrier-free immobilization based on weak intermolecular interactions
28% identity, 93% coverage: 25:387/389 of query aligns to 25:342/344 of 7xy9A
- binding magnesium ion: H101 (≠ R106), H103 (≠ N108), H158 (≠ Q176), C288 (≠ W330), G290 (≠ M332), G291 (= G333), L293 (≠ T335), R294 (≠ H336)
- binding zinc ion: C38 (= C38), H60 (= H60), E61 (= E61), D151 (= D169)
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
28% identity, 100% coverage: 1:388/389 of query aligns to 7:346/346 of 2dfvA
- active site: C40 (= C38), G41 (= G39), T42 (≠ S40), H45 (= H43), H65 (= H60), E66 (= E61), C95 (= C90), C98 (= C93), C101 (= C96), C109 (= C104), K113 (= K116), P151 (≠ L165), A155 (≠ I170), K340 (≠ C382)
- binding nicotinamide-adenine-dinucleotide: G175 (= G195), P176 (= P196), L177 (≠ V197), E197 (≠ D217), P198 (≠ Y218), R202 (= R222), F241 (≠ A260), S242 (≠ V261), A244 (≠ M263), L264 (≠ P308), G265 (= G309), L266 (≠ V310), I289 (≠ L328), T290 (= T329)
- binding zinc ion: C95 (= C90), C101 (= C96), C109 (= C104)
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
28% identity, 100% coverage: 1:388/389 of query aligns to 9:348/348 of O58389
- C42 (= C38) binding
- T44 (≠ S40) mutation to A: Total loss of enzymatic activity.
- H67 (= H60) binding
- E68 (= E61) binding
- C97 (= C90) binding
- C100 (= C93) binding
- C103 (= C96) binding
- C111 (= C104) binding
- E152 (≠ V164) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ V197) binding
- E199 (≠ D217) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (= R222) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ PGV 308:310) binding
- IT 291:292 (≠ LT 328:329) binding
- R294 (= R331) mutation to A: 4000-fold decrease in catalytic efficiency.
7f3pD Crystal structure of a NADP-dependent alcohol dehydrogenase mutant in apo form (see paper)
28% identity, 93% coverage: 25:387/389 of query aligns to 27:352/355 of 7f3pD
3fsrA Chimera of alcohol dehydrogenase by exchange of the cofactor binding domain res 153-295 of t. Brockii adh by c. Beijerinckii adh (see paper)
27% identity, 93% coverage: 25:387/389 of query aligns to 24:349/352 of 3fsrA
- active site: C37 (= C38), T38 (≠ G39), S39 (= S40), H42 (= H43), H59 (= H60), E60 (= E61), D89 (≠ C90), T92 (≠ C93), V95 (≠ C96), S103 (≠ R109), D150 (= D169), T154 (= T173), K346 (= K384)
- binding zinc ion: C37 (= C38), H59 (= H60), D150 (= D169)
P07913 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Escherichia coli (strain K12) (see paper)
28% identity, 100% coverage: 1:388/389 of query aligns to 1:339/341 of P07913
- C38 (= C38) mutation to D: Shows only 1% of wild-type catalytic activity. This mutant can be stimulated to the wild-type activity level after incubation with Zn(+).; mutation to S: Loss of catalytic activity. This mutant cannot be stimulated to the wild-type activity level after incubation with Zn(+).
5o9dA Crystal structure of r. Ruber adh-a, mutant y294f, w295a, y54f, f43h, h39y (see paper)
29% identity, 97% coverage: 1:377/389 of query aligns to 1:334/346 of 5o9dA
- active site: C38 (= C38), Y39 (≠ G39), S40 (= S40), H43 (= H43), H62 (= H60), E63 (= E61), C92 (= C90), C95 (= C93), C98 (= C96), C106 (= C104), A110 (= A114), D153 (= D169), T157 (= T173)
- binding (2~{S})-2-methylpentanedioic acid: S40 (= S40), H62 (= H60), D153 (= D169), F294 (≠ L328)
- binding nicotinamide-adenine-dinucleotide: C38 (= C38), Y39 (≠ G39), S40 (= S40), H43 (= H43), D153 (= D169), T157 (= T173), V180 (≠ A194), G181 (= G195), G182 (≠ P196), L183 (≠ V197), D203 (= D217), L204 (≠ Y218), R208 (= R222), S223 (≠ K237), F246 (≠ A260), V247 (= V261), T252 (≠ M274), V269 (≠ P308), G270 (= G309), I271 (≠ V310), F294 (≠ L328)
- binding zinc ion: C38 (= C38), H62 (= H60), C92 (= C90), C95 (= C93), C98 (= C96), C106 (= C104), D153 (= D169)
Sites not aligning to the query:
Query Sequence
>H281DRAFT_03275 FitnessBrowser__Burk376:H281DRAFT_03275
MKALRWHGKKDIRCDTVPDPKIEHPRDAIIKVSSCAICGSDLHLYDGFMPGMESGDIMGH
EFMGEVMEVGKENSALKVGDRVVVPFTIICGECDQCKRGNFSVCERSNRNKDIADKMFGH
TTAGLFGYTHLTGGYPGGQAEFVRVPFADKTHVKIPDGLSDEQVLFLGDIFPTGWQAAVQ
CDIEPTDTVAIWGAGPVGQMAIRSAVLLGAKQVIAIDYVPERLSMARAGGAVTIDFKEES
VLERLKELTGGKGPEKCIDAVGMESHATRSVDSMYDRAKQAVMLETDRPHVLREMIYVCR
PAGTLSVPGVYGGLVDKIPFGASMNKGLTWRMGQTHVNRWTDDLLRRIQEGQIDPSFVIT
HTVSLDEGPRMYKTFRDKEDGCIKVVLKP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory