SitesBLAST
Comparing H281DRAFT_03280 FitnessBrowser__Burk376:H281DRAFT_03280 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8NBZ7 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UGD; UXS-1; hUXS; hUXS1; EC 4.1.1.35 from Homo sapiens (Human) (see 4 papers)
57% identity, 93% coverage: 1:316/339 of query aligns to 83:396/420 of Q8NBZ7
- G98 (= G16) binding
- F99 (= F17) binding
- V100 (≠ L18) binding
- D119 (= D37) binding
- N120 (= N38) binding
- F122 (≠ Y40) binding
- T123 (= T41) binding
- G124 (= G42) binding
- D144 (= D62) binding
- V145 (= V63) binding
- L149 (= L67) binding
- Y150 (= Y68) binding
- L159 (= L77) binding
- S161 (≠ C79) binding
- K177 (= K95) binding
- T178 (= T96) binding
- N185 (= N103) binding
- G188 (= G106) binding
- K191 (= K109) binding
- R192 (= R110) binding
- A200 (= A118) binding
- E204 (= E122) mutation to A: Reduced UDP-glucuronic acid decarboxylase activity.
- Y231 (= Y149) active site, Proton acceptor; binding ; mutation to F: Abolished UDP-glucuronic acid decarboxylase activity.
- K235 (= K153) binding
- R236 (= R154) mutation to H: Strongly reduced UDP-glucuronic acid decarboxylase activity, caused by a local unfolding of the active site that allows for a rotation of the dimer interface, leading to the formation of a homohexamer.
- Y245 (= Y163) binding
- Q248 (= Q166) binding
- E249 (≠ H167) binding
- T261 (= T179) binding
- H267 (= H185) binding
- R272 (= R190) binding
- R361 (= R281) mutation to Q: Strongly reduced UDP-glucuronic acid decarboxylase activity.
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
2b69A Crystal structure of human udp-glucoronic acid decarboxylase
58% identity, 92% coverage: 6:316/339 of query aligns to 1:309/312 of 2b69A
- active site: T115 (= T120), S116 (= S121), E117 (= E122), Y144 (= Y149), K148 (= K153), R185 (= R190)
- binding nicotinamide-adenine-dinucleotide: G8 (= G13), G11 (= G16), F12 (= F17), V13 (≠ L18), D32 (= D37), N33 (= N38), T36 (= T41), G37 (= G42), D57 (= D62), V58 (= V63), L72 (= L77), A73 (= A78), S74 (≠ C79), A76 (= A81), T91 (= T96), T115 (= T120), Y144 (= Y149), K148 (= K153), I171 (= I176), N173 (= N178), R185 (= R190)
- binding uridine-5'-diphosphate: P61 (= P66), L62 (= L67), Y63 (= Y68), P78 (= P83), N98 (= N103), G101 (= G106), L102 (= L107), K104 (= K109), R105 (= R110), Y158 (= Y163), N173 (= N178), R185 (= R190), V186 (= V191), N189 (= N194), T201 (= T206), Y203 (= Y208), Q208 (= Q213), R210 (= R215), I244 (≠ M251), D270 (= D277)
Q6GMI9 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UXS-1; EC 4.1.1.35 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
57% identity, 93% coverage: 1:316/339 of query aligns to 81:394/418 of Q6GMI9
- R234 (= R154) mutation to H: In Man o' war (mow) mutant; characterized by severe craniofacial defects. Fishes show defective organization and morphogenesis of chondrocytes, perichondrium and bone.
4lk3B Crystal structure of human udp-xylose synthase r236a substitution (see paper)
49% identity, 92% coverage: 6:316/339 of query aligns to 1:271/274 of 4lk3B
- active site: T112 (= T120), S113 (= S121), E114 (= E122), K119 (= K153), R156 (= R190)
- binding nicotinamide-adenine-dinucleotide: G8 (= G13), G11 (= G16), F12 (= F17), V13 (≠ L18), D32 (= D37), N33 (= N38), T36 (= T41), G37 (= G42), D57 (= D62), V58 (= V63), L72 (= L77), A73 (= A78), S74 (≠ C79), P75 (= P80), T88 (= T96), A110 (= A118), T112 (= T120), K119 (= K153), I142 (= I176), H151 (= H185)
- binding uridine-5'-diphosphate: R156 (= R190), V157 (= V191), N160 (= N194), T172 (= T206), Y174 (= Y208), Q179 (= Q213), R181 (= R215), I215 (≠ M251)
- binding uridine-5'-diphosphate-glucuronic acid: P61 (= P66), L62 (= L67), Y63 (= Y68), I83 (≠ V91), K87 (= K95), N95 (= N103), G98 (= G106), L99 (= L107), K101 (= K109), Y129 (= Y163), E133 (≠ H167)
4lk3C Crystal structure of human udp-xylose synthase r236a substitution (see paper)
49% identity, 92% coverage: 6:316/339 of query aligns to 1:268/271 of 4lk3C
- active site: T110 (= T120), S111 (= S121), E112 (= E122), K117 (= K153), R154 (= R190)
- binding nicotinamide-adenine-dinucleotide: G8 (= G13), G11 (= G16), F12 (= F17), V13 (≠ L18), D32 (= D37), N33 (= N38), T36 (= T41), G37 (= G42), D57 (= D62), V58 (= V63), L72 (= L77), A73 (= A78), S74 (≠ C79), P75 (= P80), T86 (= T96), K117 (= K153), I140 (= I176), H149 (= H185)
- binding pyrophosphate 2-: R154 (= R190), V155 (= V191)
- binding uridine-5'-diphosphate-glucuronic acid: P61 (= P66), L62 (= L67), Y63 (= Y68), N93 (= N103), G96 (= G106), L97 (= L107), K99 (= K109), R100 (= R110), Y127 (= Y163), E131 (≠ H167)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
32% identity, 91% coverage: 9:316/339 of query aligns to 3:309/309 of 4zrnA
- active site: T117 (≠ S119), G119 (≠ S121), A120 (≠ E122), Y143 (= Y149), K147 (= K153), Y181 (vs. gap), G185 (≠ R190)
- binding nicotinamide-adenine-dinucleotide: G7 (= G13), G10 (= G16), F11 (= F17), I12 (≠ L18), D31 (= D37), N32 (= N38), S34 (≠ Y40), S35 (≠ T41), G36 (= G42), S51 (≠ D52), I52 (≠ C53), L73 (= L77), A74 (= A78), A75 (≠ C79), T92 (= T96), S115 (≠ Q117), S116 (≠ A118), Y143 (= Y149), K147 (= K153), Y170 (≠ I176), V173 (≠ T179)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S119), G119 (≠ S121), A120 (≠ E122), Y143 (= Y149), N172 (= N178), G185 (≠ R190), V186 (= V191), H201 (≠ T206), F203 (≠ Y208), Y208 (≠ Q213), R210 (= R215), V244 (≠ M251), R267 (≠ P274), D270 (= D277)
4m55E Crystal structure of human udp-xylose synthase r236h substitution (see paper)
37% identity, 70% coverage: 8:243/339 of query aligns to 1:156/164 of 4m55E
- active site: T105 (= T120)
- binding nicotinamide-adenine-dinucleotide: G6 (= G13), G9 (= G16), F10 (= F17), V11 (≠ L18), D30 (= D37), N31 (= N38), F32 (= F39), T34 (= T41), G35 (= G42), D55 (= D62), V56 (= V63), S72 (≠ C79), P73 (= P80), T81 (= T96), T105 (= T120), T131 (= T179)
8vr2B Crystal structure of the pcryo_0617 oxidoreductase/decarboxylase from psychrobacter cryohalolentis k5 in the presence of NAD and udp
32% identity, 93% coverage: 1:315/339 of query aligns to 2:315/321 of 8vr2B
- binding nicotinamide-adenine-dinucleotide: G14 (= G13), G17 (= G16), F18 (= F17), I19 (≠ L18), D37 (= D37), N38 (= N38), E40 (≠ Y40), R41 (≠ T41), N61 (≠ D62), V62 (= V63), A81 (= A78), A82 (≠ C79), A83 (≠ P80), F124 (≠ A118), K154 (= K153), P177 (≠ I176), N179 (= N178)
- binding uridine-5'-diphosphate: R147 (= R146), G189 (= G189), A190 (≠ V191), M194 (≠ F195), Y205 (≠ T206), I206 (≠ L207), F207 (≠ Y208), R214 (= R215), I251 (≠ M251)
6h0nA The structure of wild-type arabidopsis thaliana udp-apiose/udp-xylose synthase in complex with NAD+ and udp (see paper)
31% identity, 93% coverage: 9:322/339 of query aligns to 13:376/377 of 6h0nA
- binding nicotinamide-adenine-dinucleotide: G17 (= G13), G20 (= G16), F21 (= F17), I22 (≠ L18), D42 (= D37), V43 (≠ N38), I68 (vs. gap), N69 (vs. gap), I70 (≠ M59), L89 (= L77), A90 (= A78), A91 (≠ C79), C93 (≠ A81), S131 (= S119), T132 (= T120), Y178 (= Y149), K182 (= K153), P205 (≠ I176), N207 (= N178), W208 (≠ T179), R228 (= R190)
- binding uridine-5'-diphosphate: P95 (= P83), R175 (= R146), R228 (= R190), V229 (= V191), C232 (≠ N194), V246 (≠ Y208), R253 (= R215), V291 (≠ M251), F323 (≠ L270), Y324 (≠ H271), Y328 (≠ T275), D330 (= D277), R334 (= R281)
6h0pA The structure of c100a mutant of arabidopsis thaliana udp-apiose/udp- xylose synthase in complex with nadh and udp-d-glucuronic acid (see paper)
31% identity, 92% coverage: 9:321/339 of query aligns to 13:375/375 of 6h0pA
- binding nicotinamide-adenine-dinucleotide: G17 (= G13), G20 (= G16), F21 (= F17), I22 (≠ L18), D42 (= D37), N69 (vs. gap), I70 (≠ M59), L89 (= L77), A90 (= A78), A91 (≠ C79), A93 (= A81), F130 (≠ A118), Y178 (= Y149), K182 (= K153)
- binding uridine-5'-diphosphate-glucuronic acid: P95 (= P83), Y98 (= Y86), T132 (= T120), E134 (= E122), R175 (= R146), Y178 (= Y149), N207 (= N178), R228 (= R190), V229 (= V191), C232 (≠ N194), F233 (= F195), V246 (≠ Y208), R253 (= R215), V291 (≠ M251), F323 (≠ L270), Y324 (≠ H271), Y328 (≠ T275), D330 (= D277), R334 (= R281)
6bwlA X-ray structure of pal from bacillus thuringiensis (see paper)
29% identity, 90% coverage: 8:313/339 of query aligns to 2:311/313 of 6bwlA
- active site: T122 (= T120), C123 (≠ S121), M124 (≠ E122), Y147 (= Y149), K151 (= K153)
- binding nicotinamide-adenine-dinucleotide: G7 (= G13), G10 (= G16), F11 (= F17), I12 (≠ L18), D31 (= D37), N32 (= N38), L33 (≠ F39), N35 (≠ T41), S36 (≠ G42), D57 (≠ E57), I58 (≠ L58), L79 (= L77), A80 (= A78), A81 (≠ C79), I83 (≠ A81), M120 (≠ A118), K151 (= K153), N176 (= N178), T177 (= T179)
- binding uridine-5'-diphosphate: N176 (= N178), G189 (≠ R190), V190 (= V191), N205 (≠ T206), I206 (≠ L207), Y207 (= Y208), Q212 (= Q213), R214 (= R215), I250 (≠ M251), E275 (≠ D277)
7ys9A Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis
31% identity, 90% coverage: 8:312/339 of query aligns to 2:309/310 of 7ys9A
- binding galactose-uridine-5'-diphosphate: I81 (≠ A81), R84 (≠ I84), S121 (= S119), G123 (≠ S121), Y146 (= Y149), A174 (≠ F177), N175 (= N178), A187 (≠ G189), G188 (≠ R190), V189 (= V191), F193 (= F195), R204 (≠ T206), F206 (≠ Y208), N211 (≠ Q213), R213 (= R215), D248 (≠ M251), R271 (≠ P274)
- binding nicotinamide-adenine-dinucleotide: G7 (= G13), G10 (= G16), F11 (= F17), I12 (≠ L18), D31 (= D37), N32 (= N38), A34 (≠ Y40), T35 (= T41), G36 (= G42), D56 (= D62), I57 (vs. gap), L77 (= L77), A78 (= A78), A79 (≠ C79), I81 (≠ A81), T119 (≠ Q117), Y146 (= Y149), K150 (= K153), P173 (≠ I176), A174 (≠ F177), V176 (≠ T179)
- binding uridine-5'-diphosphate-glucose: I81 (≠ A81), R84 (≠ I84), S121 (= S119), G123 (≠ S121), Y146 (= Y149), A174 (≠ F177), N175 (= N178), A187 (≠ G189), G188 (≠ R190), V189 (= V191), F193 (= F195), R204 (≠ T206), F206 (≠ Y208), N211 (≠ Q213), R213 (= R215), D248 (≠ M251), R271 (≠ P274)
7ystA Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chain b from mycobacterium tuberculosis
31% identity, 90% coverage: 8:312/339 of query aligns to 2:309/312 of 7ystA
- binding nicotinamide-adenine-dinucleotide: G7 (= G13), G10 (= G16), F11 (= F17), I12 (≠ L18), D31 (= D37), N32 (= N38), T35 (= T41), G36 (= G42), D56 (= D62), I57 (vs. gap), L77 (= L77), A78 (= A78), A79 (≠ C79), I81 (≠ A81), V96 (≠ T96), T119 (≠ Q117), Y146 (= Y149), K150 (= K153), P173 (≠ I176), A174 (≠ F177), N175 (= N178), V176 (≠ T179)
- binding uridine-5'-diphosphate-glucose: I81 (≠ A81), R84 (≠ I84), S121 (= S119), G123 (≠ S121), Y146 (= Y149), A174 (≠ F177), N175 (= N178), A187 (≠ G189), G188 (≠ R190), V189 (= V191), F193 (= F195), R204 (≠ T206), V205 (≠ L207), F206 (≠ Y208), R213 (= R215), D248 (≠ M251), R271 (≠ P274)
7ysmA Crystal structure of udp-glucose 4-epimerase (rv3634c) co-crystallized with udp-n-acetylglucosamine from mycobacterium tuberculosis
31% identity, 90% coverage: 8:312/339 of query aligns to 2:309/311 of 7ysmA
- binding nicotinamide-adenine-dinucleotide: G7 (= G13), G10 (= G16), F11 (= F17), I12 (≠ L18), D31 (= D37), N32 (= N38), T35 (= T41), G36 (= G42), D56 (= D62), I57 (vs. gap), L77 (= L77), A78 (= A78), A79 (≠ C79), I81 (≠ A81), T119 (≠ Q117), Y146 (= Y149), K150 (= K153), P173 (≠ I176), N175 (= N178), V176 (≠ T179)
- binding uridine-diphosphate-n-acetylgalactosamine: I81 (≠ A81), R84 (≠ I84), S121 (= S119), G123 (≠ S121), S124 (≠ E122), Y146 (= Y149), A174 (≠ F177), N175 (= N178), G188 (≠ R190), V189 (= V191), F193 (= F195), R204 (≠ T206), V205 (≠ L207), F206 (≠ Y208), N211 (≠ Q213), R213 (= R215), D248 (≠ M251), R271 (≠ P274)
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
31% identity, 90% coverage: 8:312/339 of query aligns to 2:311/321 of 6zllA
- active site: T126 (= T120), S127 (= S121), S128 (≠ E122), Y149 (= Y149), K153 (= K153)
- binding nicotinamide-adenine-dinucleotide: G7 (= G13), G10 (= G16), F11 (= F17), I12 (≠ L18), D32 (= D37), H33 (≠ N38), F34 (= F39), I35 (≠ Y40), K43 (≠ T43), D62 (= D62), I63 (≠ V63), L81 (= L77), A82 (= A78), A83 (≠ C79), I124 (≠ A118), T126 (= T120), Y149 (= Y149), K153 (= K153), Y176 (≠ I176), V179 (≠ T179), R185 (≠ H185), M188 (≠ R190)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (= P80), V87 (≠ S82), R88 (≠ P83), T126 (= T120), S127 (= S121), Y149 (= Y149), T178 (≠ N178), R185 (≠ H185), A189 (≠ V191), R192 (≠ N194), T204 (= T206), F206 (≠ Y208), Q211 (= Q213), R213 (= R215), I250 (≠ M251), E276 (≠ D277)
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
31% identity, 90% coverage: 8:312/339 of query aligns to 2:311/314 of 6zldA
- active site: T126 (= T120), S127 (= S121), S128 (≠ E122), Y149 (= Y149), K153 (= K153)
- binding nicotinamide-adenine-dinucleotide: G7 (= G13), G10 (= G16), F11 (= F17), I12 (≠ L18), D32 (= D37), H33 (≠ N38), F34 (= F39), I35 (≠ Y40), K43 (≠ T43), D62 (= D62), I63 (≠ V63), L81 (= L77), A82 (= A78), A83 (≠ C79), I124 (≠ A118), T126 (= T120), K153 (= K153), Y176 (≠ I176), T178 (≠ N178), R185 (≠ H185), M188 (≠ R190)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (= P80), R88 (≠ P83), T126 (= T120), S127 (= S121), S128 (≠ E122), Y149 (= Y149), F177 (= F177), T178 (≠ N178), R185 (≠ H185), M188 (≠ R190), A189 (≠ V191), R192 (≠ N194), T204 (= T206), F206 (≠ Y208), Q211 (= Q213), R213 (= R215), I250 (≠ M251), E276 (≠ D277)
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
31% identity, 90% coverage: 8:312/339 of query aligns to 2:311/314 of 6zl6A
- active site: T126 (= T120), S127 (= S121), S128 (≠ E122), Y149 (= Y149), K153 (= K153)
- binding nicotinamide-adenine-dinucleotide: G7 (= G13), G10 (= G16), F11 (= F17), I12 (≠ L18), D32 (= D37), H33 (≠ N38), F34 (= F39), I35 (≠ Y40), K43 (≠ T43), D62 (= D62), I63 (≠ V63), L81 (= L77), A82 (= A78), A83 (≠ C79), I124 (≠ A118), T126 (= T120), K153 (= K153), Y176 (≠ I176), T178 (≠ N178), V179 (≠ T179), R185 (≠ H185), M188 (≠ R190)
- binding uridine-5'-diphosphate: T178 (≠ N178), A189 (≠ V191), R192 (≠ N194), T204 (= T206), F206 (≠ Y208), Q211 (= Q213), R213 (= R215), I250 (≠ M251), E276 (≠ D277)
6zljA Crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and NAD (see paper)
31% identity, 90% coverage: 8:312/339 of query aligns to 2:311/314 of 6zljA
- active site: T126 (= T120), S127 (= S121), S128 (≠ E122), F149 (≠ Y149), K153 (= K153)
- binding nicotinamide-adenine-dinucleotide: G7 (= G13), G10 (= G16), F11 (= F17), I12 (≠ L18), D32 (= D37), H33 (≠ N38), F34 (= F39), I35 (≠ Y40), K43 (≠ T43), D62 (= D62), I63 (≠ V63), L81 (= L77), A82 (= A78), A83 (≠ C79), I124 (≠ A118), T126 (= T120), K153 (= K153), Y176 (≠ I176), T178 (≠ N178), V179 (≠ T179), R185 (≠ H185), M188 (≠ R190)
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: P85 (= P80), R88 (≠ P83), T126 (= T120), S127 (= S121), S128 (≠ E122), F149 (≠ Y149), F177 (= F177), T178 (≠ N178), R185 (≠ H185), M188 (≠ R190), A189 (≠ V191), R192 (≠ N194), T204 (= T206), F206 (≠ Y208), Q211 (= Q213), R213 (= R215), I250 (≠ M251), E276 (≠ D277)
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
31% identity, 89% coverage: 7:309/339 of query aligns to 1:305/307 of 6wjaA
- active site: A118 (≠ T120), A119 (≠ S121), A120 (≠ E122), F143 (≠ Y149), K147 (= K153)
- binding nicotinamide-adenine-dinucleotide: G7 (= G13), G10 (= G16), F11 (= F17), I12 (≠ L18), D31 (= D37), D32 (≠ N38), S34 (≠ Y40), T35 (= T41), G36 (= G42), A55 (≠ V63), L74 (= L77), A75 (= A78), A76 (≠ C79), S93 (≠ T96), F143 (≠ Y149), K147 (= K153), F170 (≠ I176), F171 (= F177), I173 (≠ T179)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (≠ P83), A120 (≠ E122), N172 (= N178), G186 (≠ R190), V187 (= V191), F191 (= F195), T202 (= T206), F204 (≠ Y208), R211 (= R215), L247 (≠ M251), R270 (≠ P274), D273 (= D277)
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
31% identity, 89% coverage: 7:309/339 of query aligns to 2:306/308 of 6wj9B
- active site: A119 (≠ T120), A120 (≠ S121), A121 (≠ E122), F144 (≠ Y149), K148 (= K153)
- binding nicotinamide-adenine-dinucleotide: G8 (= G13), G11 (= G16), F12 (= F17), I13 (≠ L18), D32 (= D37), D33 (≠ N38), S35 (≠ Y40), T36 (= T41), G37 (= G42), D55 (= D62), A56 (≠ V63), L75 (= L77), A76 (= A78), A77 (≠ C79), S94 (≠ T96), A117 (= A118), A119 (≠ T120), F144 (≠ Y149), K148 (= K153), F171 (≠ I176), F172 (= F177), I174 (≠ T179)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (≠ P83), N173 (= N178), G187 (≠ R190), V188 (= V191), F192 (= F195), T203 (= T206), L204 (= L207), F205 (≠ Y208), R212 (= R215), L248 (≠ M251), R271 (≠ P274), D274 (= D277)
Query Sequence
>H281DRAFT_03280 FitnessBrowser__Burk376:H281DRAFT_03280
MKELTRKRILVTGGAGFLGSHLCERLVTQGHDVLCVDNFYTGTKDNIAHLLDCPNFELMR
HDVTFPLYVEVDEIYNLACPASPIHYQHDPVQTTKTSVHGAINMLGLAKRVKARIFQAST
SEVYGDALVHPQKEDYWGHVNPIGPRSCYDEGKRCAETLFMDYRRQHGLSIRIARIFNTY
GPRMHPADGRVVSNFMMQALRGEPITLYGDGSQTRSFCYVDDMIDAFIRLMNTAEDPGGP
VNLGNPHEVSMREIAQRIVAITGSSSPLELHPLPTDDPWHRQPDISRARELLGWQPKTSL
DDGLKETARYFRARIEASSEATGDVASIGAHADQRPALT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory