Comparing H281DRAFT_03298 FitnessBrowser__Burk376:H281DRAFT_03298 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q46444 Quinohemoprotein alcohol dehydrogenase; QH-ADH; Alcohol dehydrogenase (azurin); PQQ-containing alcohol dehydrogenase; PQQ-dependent ADH; Quinohaemoprotein ethanol dehydrogenase type I; QH-EDHI; EC 1.1.9.1 from Comamonas testosteroni (Pseudomonas testosteroni) (see 3 papers)
25% identity, 55% coverage: 383:866/879 of query aligns to 161:577/708 of Q46444
Sites not aligning to the query:
1kb0A Crystal structure of quinohemoprotein alcohol dehydrogenase from comamonas testosteroni (see paper)
25% identity, 55% coverage: 383:866/879 of query aligns to 130:546/670 of 1kb0A
Sites not aligning to the query:
O05542 Alcohol dehydrogenase (quinone), dehydrogenase subunit; ADH; Alcohol dehydrogenase (quinone), acceptor subunit; Alcohol dehydrogenase (quinone), subunit I; Ethanol:Q2 reductase; G3-ADH subunit I; Quinohemoprotein alcohol dehydrogenase; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
35% identity, 14% coverage: 160:285/879 of query aligns to 40:157/757 of O05542
Sites not aligning to the query:
8gy2A Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
35% identity, 14% coverage: 160:285/879 of query aligns to 6:123/723 of 8gy2A
Sites not aligning to the query:
2d0vA Crystal structure of methanol dehydrogenase from hyphomicrobium denitrificans (see paper)
23% identity, 55% coverage: 379:860/879 of query aligns to 119:536/597 of 2d0vA
Sites not aligning to the query:
5xm3A Crystal structure of methanol dehydrogenase from methylophaga aminisulfidivorans (see paper)
27% identity, 28% coverage: 357:602/879 of query aligns to 97:346/596 of 5xm3A
Sites not aligning to the query:
7ce5A Methanol-pqq bound methanol dehydrogenase (mdh) from methylococcus capsulatus (bath) (see paper)
25% identity, 28% coverage: 357:599/879 of query aligns to 97:342/573 of 7ce5A
Sites not aligning to the query:
7cdlC Holo-methanol dehydrogenase (mdh) with cys131-cys132 reduced from methylococcus capsulatus (bath) (see paper)
25% identity, 28% coverage: 357:599/879 of query aligns to 97:342/573 of 7cdlC
Sites not aligning to the query:
Q4W6G0 Quinohemoprotein alcohol dehydrogenase ADH-IIG; ADH IIG; Alcohol dehydrogenase (azurin); EC 1.1.9.1 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
23% identity, 56% coverage: 383:870/879 of query aligns to 152:577/718 of Q4W6G0
Sites not aligning to the query:
1yiqA Molecular cloning and structural analysis of quinohemoprotein alcohol dehydrogenase adhiig from pseudomonas putida hk5. Compariison to the other quinohemoprotein alcohol dehydrogenase adhiib found in the same microorganism. (see paper)
23% identity, 56% coverage: 383:870/879 of query aligns to 123:548/684 of 1yiqA
Sites not aligning to the query:
6damA Crystal structure of lanthanide-dependent methanol dehydrogenase xoxf from methylomicrobium buryatense 5g (see paper)
26% identity, 25% coverage: 383:603/879 of query aligns to 117:344/563 of 6damA
Sites not aligning to the query:
4aahA Methanol dehydrogenase from methylophilus w3a1 (see paper)
27% identity, 26% coverage: 383:609/879 of query aligns to 117:346/571 of 4aahA
Sites not aligning to the query:
1kv9A Structure at 1.9 a resolution of a quinohemoprotein alcohol dehydrogenase from pseudomonas putida hk5 (see paper)
27% identity, 25% coverage: 383:602/879 of query aligns to 119:337/664 of 1kv9A
Sites not aligning to the query:
Q8GR64 Quinohemoprotein alcohol dehydrogenase ADH IIB; ADH IIB; Alcohol dehydrogenase (azurin); EC 1.1.9.1 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 3 papers)
27% identity, 25% coverage: 383:602/879 of query aligns to 141:359/690 of Q8GR64
Sites not aligning to the query:
4maeA Methanol dehydrogenase from methylacidiphilum fumariolicum solv (see paper)
26% identity, 29% coverage: 383:640/879 of query aligns to 118:360/577 of 4maeA
Sites not aligning to the query:
6fkwA Europium-containing methanol dehydrogenase (see paper)
26% identity, 29% coverage: 383:640/879 of query aligns to 118:360/576 of 6fkwA
Sites not aligning to the query:
6oc6A Lanthanide-dependent methanol dehydrogenase xoxf from methylobacterium extorquens, in complex with lanthanum and pyrroloquinoline quinone (see paper)
26% identity, 26% coverage: 384:610/879 of query aligns to 118:347/579 of 6oc6A
Sites not aligning to the query:
7o6zB Structure of a neodymium-containing, xoxf1-type methanol dehydrogenase (see paper)
26% identity, 25% coverage: 383:602/879 of query aligns to 119:356/588 of 7o6zB
Sites not aligning to the query:
7o6zA Structure of a neodymium-containing, xoxf1-type methanol dehydrogenase (see paper)
26% identity, 25% coverage: 383:602/879 of query aligns to 119:356/588 of 7o6zA
Sites not aligning to the query:
6zcvA Crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440
25% identity, 25% coverage: 384:602/879 of query aligns to 119:338/562 of 6zcvA
Sites not aligning to the query:
>H281DRAFT_03298 FitnessBrowser__Burk376:H281DRAFT_03298
MSKPHRFPPALAVPAVVFIIIGLALAGGGVPLVALGGSWYYVVTGIAIALTGVLLSIRRR
SALWLFALILFGSTIWAVVEARFDFWQLLPRLWVWLVLALWLLLPPVTRKLVFGPPAAHR
EGVVPLTAAVILTVLLGLVTAFNHPYDRAGTLASTAAPPTTPIAGDANRQAADWTDYGGS
PLGQRYSPLTQITPENAGQLKVAWQFETGDKPGPGDPTETTDENTPIKVGNKLFLCTPHS
IVIALDPASGKELWRYDPHIQSPVGFKHWEHMTCRGVSYHDDAMYPANAAVAAADNAAAS
APTEGAAAGAPASTDASAAASNPQASASAPAADGASATTDAANGASTAAGAEQSASAATA
ASDTSAATQQTAAAAVSAECPRRIFLPTADARLIALNADTGQPCTHFGNNGQIDLRTNIG
PFTPGGYYSTSPPAVTRDLVIISGHVTDNESTNEPSGVTRAFDVHDGHLVWNWDAGNPDE
TQPITGNQTYVRNSPNMWSVFSVDEKLGMVYLPLGNQTPDQWGGMRTPASEKVAAGVVAL
DLATGKMRWNYQFTHHDLWDMDVGGQPSLIDLQTPSGVQPALIASTKQGSLYVLNRETGK
PIVPITEEPVPQGAGTGDHTSPTQPFSALNFKPPKVRERDMWGTNPFDQLWCRVKFKSLR
YDGMFTPPSEQGSLVFPGNFGVFDWGGIAVDPVRQILIANPSYMAFTSKLVPRSQIPSDN
GEKKGSETSGIKLARGTPYGFELNAFLSPLGIPCQAPPWGYVAGVDLRTNHIVWEHKNGT
IRDSAPLPIPMPLGVPSLGGMITTAGGVAFLSGTLDYYLRAYDVRTGDRLWQARLPAGGQ
ATPMTYADSNGKQYVLVTAGGHGSLGTKQGDYVIAYTLP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory