SitesBLAST
Comparing H281DRAFT_03306 FitnessBrowser__Burk376:H281DRAFT_03306 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
46% identity, 90% coverage: 38:429/434 of query aligns to 42:434/478 of Q47945
Sites not aligning to the query:
- 1:36 signal peptide
- 37 modified: Pyrrolidone carboxylic acid
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
46% identity, 90% coverage: 38:429/434 of query aligns to 4:396/433 of 8gy2B
- binding heme c: C18 (= C52), C21 (= C55), H22 (= H56), T46 (≠ S80), I48 (= I82), Y59 (= Y93), L68 (≠ V102), R73 (≠ S107), V79 (≠ L113), Y80 (= Y114), M83 (= M117), F88 (= F122), R126 (= R160), H165 (= H198), C166 (= C199), C169 (= C202), H170 (= H203), I201 (≠ F232), A202 (≠ G233), P203 (= P234), L205 (= L236), W216 (≠ I247), F224 (= F255), A234 (≠ V265), V235 (≠ A266), F236 (= F267), F236 (= F267), M239 (= M270), N301 (≠ F335), C302 (= C336), C305 (= C339), H306 (= H340), M316 (≠ V350), F317 (= F351), P318 (= P352), L320 (= L354), P324 (= P358), G342 (= G376), S352 (≠ P386), V354 (≠ Q388), M356 (= M390), F359 (= F393), M375 (≠ I409)
- binding ubiquinone-10: C21 (= C55), L34 (= L68), P39 (= P73), P81 (= P115), L129 (= L163), W132 (= W166), E168 (≠ A201), R173 (= R206), I197 (≠ N228), D241 (≠ E272)
Sites not aligning to the query:
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
36% identity, 90% coverage: 40:429/434 of query aligns to 1:400/413 of 8jejC
- binding heme c: C13 (= C52), C16 (= C55), H17 (= H56), T42 (≠ S80), I44 (= I82), F60 (= F98), L64 (≠ V102), L75 (= L113), Y76 (= Y114), M79 (= M117), P80 (= P118), Y84 (≠ F122), R122 (= R160), C162 (= C199), C165 (= C202), H166 (= H203), I186 (≠ N228), W189 (= W231), A191 (≠ G233), P192 (= P234), I194 (≠ L236), W205 (≠ I247), Y213 (≠ F255), R223 (≠ V265), M228 (= M270), V303 (≠ F335), C304 (= C336), C307 (= C339), H308 (= H340), Y320 (≠ F351), P321 (= P352), L323 (= L354), T327 (≠ P358), T328 (≠ S359), D336 (≠ S367), I341 (≠ M372), V345 (≠ G376), R347 (≠ S378), I354 (≠ Q388), M356 (= M390), F359 (= F393), I376 (≠ V405)
- binding ubiquinone-10: M36 (≠ F74), P77 (= P115), S124 (≠ V162), W128 (= W166), C165 (= C202), L173 (≠ F210)
Sites not aligning to the query:
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
36% identity, 90% coverage: 40:429/434 of query aligns to 1:386/418 of 7w2jC
- binding heme c: C13 (= C52), C16 (= C55), H17 (= H56), T42 (≠ S80), I44 (= I82), Y55 (= Y93), L75 (= L113), Y76 (= Y114), A78 (= A116), M79 (= M117), R122 (= R160), H161 (= H198), C162 (= C199), C165 (= C202), H166 (= H203), A191 (≠ G233), P192 (= P234), R223 (≠ V265), P227 (≠ S269), M228 (= M270), V289 (≠ F335), C290 (= C336), C293 (= C339), H294 (= H340), Y305 (≠ V350), Y306 (≠ F351), P307 (= P352), L309 (= L354), N312 (= N357), T313 (≠ P358), T314 (≠ S359), D322 (≠ S367), I327 (≠ M372), V331 (≠ G376), R333 (≠ S378), I340 (≠ Q388), M342 (= M390), P343 (= P391), F345 (= F393)
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
32% identity, 94% coverage: 7:412/434 of query aligns to 8:410/440 of 8gy3A
- binding heme c: Y52 (≠ D51), C53 (= C52), C56 (= C55), H57 (= H56), S84 (= S80), I86 (= I82), W97 (≠ Y93), F102 (= F98), L117 (= L113), F121 (≠ M117), F126 (= F122), R163 (= R160), C203 (= C199), C206 (= C202), H207 (= H203), A232 (≠ G233), P233 (= P234), L235 (= L236), W245 (≠ I247), Y253 (≠ F255), L254 (= L256), G263 (= G261), S264 (≠ A262), M269 (= M270), Y292 (≠ V293), C337 (= C336), C340 (= C339), H341 (= H340), P353 (= P352), L355 (= L354), N358 (= N357), N359 (≠ P358), V372 (≠ L371), I377 (≠ G376), G382 (= G384), Q383 (≠ P385), I386 (≠ Q388), M388 (= M390), F391 (= F393)
- binding ubiquinone-10: E55 (≠ G54), T76 (≠ S72), F78 (= F74), Y118 (= Y114), P119 (= P115), I160 (≠ F157), G166 (≠ L163), Q167 (≠ Y164), F169 (= F165), W170 (= W166), H202 (= H198), R210 (= R206), L213 (≠ R213)
8hddB Complex structure of catalytic, small, and a partial electron transfer subunits from burkholderia cepacia fad glucose dehydrogenase
32% identity, 23% coverage: 329:429/434 of query aligns to 23:121/121 of 8hddB
- binding protoporphyrin ix containing fe: C30 (= C336), C33 (= C339), H34 (= H340), Y46 (≠ F351), P47 (= P352), T54 (≠ S359), V66 (≠ L371), I67 (≠ M372), R73 (≠ S378), I80 (≠ Q388), M82 (= M390), P83 (= P391)
4ax3D Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.6 a resolution (see paper)
30% identity, 24% coverage: 328:431/434 of query aligns to 355:457/457 of 4ax3D
- binding heme c: C363 (= C336), C366 (= C339), H367 (= H340), P379 (= P352), P380 (≠ R353), L381 (= L354), S384 (≠ N357), F386 (≠ V360), N403 (= N377), G404 (≠ S378), S415 (≠ A389), M417 (= M390), M420 (≠ F393)
Sites not aligning to the query:
- active site: 93, 96, 98, 133, 134, 142, 147, 239, 261, 262, 288
- binding copper (ii) ion: 93, 98, 133, 134, 142, 147
6fjaA Crystal structure of t2d three-domain heme-cu nitrite reductase from ralstonia pickettii
30% identity, 24% coverage: 328:431/434 of query aligns to 352:454/455 of 6fjaA
- binding protoporphyrin ix containing fe: T359 (≠ F335), C360 (= C336), C363 (= C339), H364 (= H340), P376 (= P352), P377 (≠ R353), L378 (= L354), F383 (≠ V360), N400 (= N377), G401 (≠ S378), Y410 (≠ R387), S412 (≠ A389), M414 (= M390), M417 (≠ F393)
Sites not aligning to the query:
- active site: 90, 93, 95, 130, 131, 139, 144, 236, 258, 259, 285
- binding copper (ii) ion: 90, 131, 139, 144
5oboA Crystal structure of nitrite bound d97n mutant of three-domain heme-cu nitrite reductase from ralstonia pickettii
30% identity, 24% coverage: 328:431/434 of query aligns to 353:455/456 of 5oboA
- binding heme c: T360 (≠ F335), C361 (= C336), C364 (= C339), H365 (= H340), P377 (= P352), P378 (≠ R353), L379 (= L354), S382 (≠ N357), F384 (≠ V360), I395 (≠ L371), N401 (= N377), G402 (≠ S378), S413 (≠ A389), M415 (= M390), M418 (≠ F393)
Sites not aligning to the query:
- active site: 91, 94, 96, 131, 132, 140, 145, 237, 259, 260, 286
- binding copper (ii) ion: 91, 96, 131, 132, 140, 145
- binding nitrite ion: 94, 96, 131
1c52A Thermus thermophilus cytochrome-c552: a new highly thermostable cytochromE-C structure obtained by mad phasing (see paper)
34% identity, 25% coverage: 325:431/434 of query aligns to 1:114/131 of 1c52A
- binding protoporphyrin ix containing fe: C11 (= C336), C14 (= C339), H15 (= H340), F26 (= F351), P27 (= P352), L29 (= L354), H32 (≠ N357), Y45 (vs. gap), L54 (≠ G376), Q55 (≠ N377), G56 (≠ S378), G67 (≠ A389), M69 (= M390), F72 (= F393)
Sites not aligning to the query:
1dt1A Thermus thermophilus cytochrome c552 synthesized by escherichia coli (see paper)
34% identity, 24% coverage: 328:431/434 of query aligns to 2:112/129 of 1dt1A
- binding heme c: C9 (= C336), C12 (= C339), H13 (= H340), P25 (= P352), H30 (≠ N357), Y43 (vs. gap), V47 (≠ L371), Q53 (≠ N377), G54 (≠ S378), G65 (≠ A389), M67 (= M390), F70 (= F393)
Sites not aligning to the query:
1r0qA Characterization of the conversion of the malformed, recombinant cytochrome rc552 to a 2-formyl-4-vinyl (spirographis) heme (see paper)
34% identity, 24% coverage: 328:431/434 of query aligns to 3:113/130 of 1r0qA
- binding 2-formyl-protoporphryn ix: C13 (= C339), H14 (= H340), P26 (= P352), L28 (= L354), H31 (≠ N357), Y44 (vs. gap), V48 (≠ L371), Q54 (≠ N377), G55 (≠ S378), G66 (≠ A389), M68 (= M390)
Sites not aligning to the query:
1qyzA Characterization of the malformed, recombinant cytochrome rc552 (see paper)
34% identity, 24% coverage: 328:431/434 of query aligns to 3:113/130 of 1qyzA
- binding 2-acetyl-protoporphyrin ix: Y7 (= Y332), C10 (= C336), C13 (= C339), H14 (= H340), P26 (= P352), H31 (≠ N357), Y44 (vs. gap), Q54 (≠ N377), G55 (≠ S378), G66 (≠ A389), M68 (= M390), F71 (= F393)
Sites not aligning to the query:
2zooA Crystal structure of nitrite reductase from pseudoalteromonas haloplanktis tac125
27% identity, 26% coverage: 319:429/434 of query aligns to 330:438/438 of 2zooA
- binding protoporphyrin ix containing fe: C347 (= C336), C350 (= C339), H351 (= H340), F362 (= F351), P363 (= P352), P364 (≠ R353), L365 (= L354), S368 (≠ P358), Y370 (≠ V360), I382 (≠ M372), L386 (≠ G376), S387 (≠ N377), G388 (≠ S378), I390 (≠ A380), V392 (≠ I382), Y397 (≠ R387), N398 (≠ Q388), G399 (vs. gap), V400 (≠ A389), M401 (= M390)
Sites not aligning to the query:
- active site: 81, 84, 86, 121, 122, 130, 135, 227, 249, 250, 276
- binding copper (ii) ion: 81, 86, 121, 122, 130, 135
Query Sequence
>H281DRAFT_03306 FitnessBrowser__Burk376:H281DRAFT_03306
MMRRFKLIVLAGTAMLGAFTTPCVTAEPAGASDPALAALVARGEYLAKASDCAGCHTAVG
GQAYGGGLGLTSPFGTIMSSNITPDRRYGIGAYSYEDFARSVREGVSPGNKRLYPAMPYA
SFSKMSDDDMRALYAYFMHGVKPAPEPAPPTKLAFPFNQRWVLYFWQLAFAPTEPYRPKA
GRDAQWNRGAFLVQGPGHCGACHTPRGPGFQERGYDESSPMYLTGGVNDNWFGPNLTGDP
GSGLGRIGEKDLAAFLKTGHGAGLVAFGSMVEQVEDSTQYLTDEDALAMAHYVKSLPAQK
PSGSYEPHAQPDLPTRNGNRVDAPQSVGARVYISFCARCHGVQGAGMPNVFPRLAGNPSV
ITEDTTSLIRLMVEGGNSPATISGPPRQAMPGFAQTLTNAQMANVLSWIRTSWGNDARPV
TANDIQSLREKIHK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory