SitesBLAST – Find functional sites

 

SitesBLAST

Comparing H281DRAFT_03338 FitnessBrowser__Burk376:H281DRAFT_03338 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 11 hits to proteins with known functional sites (download)

A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
25% identity, 73% coverage: 78:392/432 of query aligns to 63:398/446 of A0A0H2VG78

query
sites
A0A0H2VG78
G
 
G
A
 
P
Y
 
L
I
 
A
D
 
D
D
 
K
V
 
L
G
 
G
R
 
R
R
 
R
K
 
R
G
 
L
L
 
V
I
 
M
V
 
L
T
 
I
L
 
A
S
 
I
I
 
V
M
 
F
A
 
I
S
 
I
G
 
G
T
 
A
I
 
L
L
 
I
I
 
L
A
 
A
F
 
-
V
 
-
P
 
-
G
 
-
Y
 
-
A
 
A
T
 
S
L
 
T
G
 
N
L
 
L
L
 
-
A
 
-
P
 
-
A
 
A
L
 
L
V
 
L
L
 
I
I
 
I
G
 
G
R
|
R
L
 
L
L
 
I
Q
x
I
G
 
G
F
 
L
S
 
A
A
 
V
G
 
G
A
 
G
E
 
S
L
 
M
G
 
S
G
 
T
V
 
V
S
 
P
V
 
V
Y
 
Y
L
 
L
A
 
S
E
|
E
M
 
M
A
 
A
T
 
P
P
 
T
G
 
E
R
 
Y
K
 
R
G
 
G
F
 
S
F
 
L
T
 
G
S
 
S
W
 
L
Q
 
N
S
x
Q
A
 
L
S
 
M
Q
 
I
Q
 
T
V
 
I
A
 
G
I
 
I
V
 
L
V
 
A
A
 
A
A
 
Y
A
 
L
L
 
V
G
 
N
F
 
Y
A
 
A
L
 
F
N
 
-
Q
 
-
S
 
-
M
 
-
S
 
-
A
 
-
A
 
A
T
 
D
I
 
I
A
 
E
S
 
G
W
 
W
G
 
R
W
 
W
R
 
-
V
 
-
P
 
-
F
 
-
F
 
M
V
 
L
G
 
G
C
 
L
M
 
A
I
 
V
V
 
V
P
 
P
F
 
S
I
 
V
F
 
I
M
 
L
L
 
L
-
 
V
-
 
G
-
 
I
-
 
Y
-
 
F
-
 
M
-
 
P
-
 
E
-
 
S
-
 
P
R
 
R
R
 
W
N
 
L
L
 
L
Q
 
E
E
 
N
T
 
R
E
 
N
E
 
E
F
 
E
K
 
A
A
 
A
R
 
R
Q
 
Q
-
 
V
-
 
M
-
 
K
-
 
I
-
 
T
-
 
Y
-
 
D
-
 
D
-
 
S
-
 
E
-
 
I
-
 
D
-
 
K
H
 
E
R
 
L
P
 
K
S
 
E
M
 
M
K
 
K
E
 
E
V
 
I
F
 
N
R
 
A
T
 
I
L
 
S
V
 
E
Q
 
S
N
 
T
W
 
W
T
 
T
V
 
V
V
 
I
-
 
K
-
 
S
-
 
P
-
 
W
I
 
L
A
 
G
G
 
R
M
 
I
M
 
L
L
 
I
V
 
V
A
 
G
M
 
C
T
 
I
T
 
F
A
 
A
S
 
I
F
 
F
-
x
Q
Y
x
Q
L
 
F
I
 
I
T
 
G
V
 
I
Y
x
N
A
 
A
P
 
V
T
 
I
F
 
F
G
 
Y
K
 
S
T
 
S
V
 
S
L
 
I
H
 
F
-
 
A
-
 
K
-
 
A
-
 
G
L
 
L
S
 
G
T
 
E
A
 
A
D
 
A
S
 
S
L
 
I
L
 
L
V
 
G
T
 
S
L
 
V
C
 
G
V
 
I
A
 
G
V
 
T
S
 
I
N
 
N
F
 
V
V
 
L
W
 
V
L
 
T
P
 
I
I
 
V
G
 
A
G
 
I
A
 
F
L
 
V
S
 
V
D
 
D
K
 
K
L
 
I
G
 
D
R
 
R
R
 
K
P
 
K
L
 
L
L
 
L
V
 
V
A
 
G
M
 
G
T
 
N
V
 
I
L
 
G
A
 
M
I
 
I
A
 
A
T
 
S
A
 
L
Y
 
L
P
 
I
A
 
M
L
 
A
S
 
I
L
 
L
-
 
I
-
 
W
-
 
T
L
 
I
A
 
G
H
 
I
A
 
A
P
 
S
S
 
S
F
 
A
L
 
W
N
 
I
M
 
I
L
 
I
L
 
V
A
 
C
L
 
L
L
 
S
W
 
L
L
 
F
S
 
I
F
 
V
M
 
F
Y
 
F
G
 
G
I
 
I
Y
 
S
N
 
W
G
 
G
A
 
P
M
 
V
V
 
L
-
x
W
V
 
V
A
 
M
L
 
L
T
 
P
E
 
E
V
 
L
M
 
F
P
 
P
A
 
M
Q
 
R
V
 
A
R
 
R
V
 
G
A
 
A
-
 
A
-
 
T
G
 
G
F
 
I
S
 
S
-
 
A
L
 
L
A
 
V
Y
 
L
S
 
N
L
 
I
A
 
G
T
 
T
A
 
L
V
 
I
F
 
V
G
 
S
G
 
L
F
 
F
T
 
F
P
 
P
A
 
I
I
 
L
S
 
S
T
 
D
A
 
A
L
 
L

Sites not aligning to the query:

8k77A Synaptic vesicle glycoprotein 2A
29% identity, 28% coverage: 72:191/432 of query aligns to 81:184/592 of 8k77A

query
sites
8k77A
L
 
V
G
 
G
A
 
A
I
 
F
V
 
L
L
 
W
G
 
G
A
 
G
Y
 
L
I
 
A
D
 
D
D
 
R
V
 
L
G
 
G
R
 
R
R
 
R
K
 
Q
G
 
C
L
 
L
I
 
L
V
 
I
T
 
S
L
 
L
S
 
S
I
 
V
M
 
N
A
 
S
S
 
V
G
 
F
T
 
A
I
 
F
L
 
F
I
 
S
A
 
S
F
 
F
V
 
V
P
 
Q
G
 
G
Y
 
Y
A
 
G
T
 
T
L
 
F
G
 
-
L
 
-
L
 
-
A
 
-
P
 
-
A
 
-
L
 
-
V
 
-
L
 
L
I
 
F
G
 
C
R
 
R
L
 
L
L
 
L
Q
 
S
G
 
G
F
 
V
S
 
G
A
 
I
G
 
G
A
 
G
E
 
S
L
 
I
G
 
P
G
 
I
V
 
V
S
 
F
V
 
S
Y
 
Y
L
 
F
A
 
S
E
 
E
M
 
F
A
 
L
T
 
A
P
 
Q
G
 
E
R
 
K
K
 
R
G
 
G
F
 
E
F
 
H
T
 
L
S
 
S
W
 
W
Q
 
L
S
 
C
A
 
M
S
 
F
Q
x
W
Q
 
M
V
 
I
A
 
G
I
 
G
V
 
V
V
 
Y
A
 
A
A
 
A
A
 
A
L
 
M
G
 
A
F
 
W
A
 
A
L
 
I
N
 
-
Q
 
-
S
 
-
M
 
-
S
 
-
A
 
-
A
 
-
T
 
-
I
 
I
A
 
P
S
 
H
W
 
Y
G
 
G
W
 
W

Sites not aligning to the query:

8jlhA Cryo-em structure of sv2a dimer in complex with bont/a2 hc and levetiracetam
29% identity, 28% coverage: 72:191/432 of query aligns to 81:184/592 of 8jlhA

query
sites
8jlhA
L
 
V
G
 
G
A
 
A
I
 
F
V
 
L
L
 
W
G
 
G
A
 
G
Y
 
L
I
 
A
D
 
D
D
 
R
V
 
L
G
 
G
R
 
R
R
 
R
K
 
Q
G
 
C
L
 
L
I
 
L
V
 
I
T
 
S
L
 
L
S
 
S
I
 
V
M
 
N
A
 
S
S
 
V
G
 
F
T
 
A
I
 
F
L
 
F
I
 
S
A
 
S
F
 
F
V
 
V
P
 
Q
G
 
G
Y
 
Y
A
 
G
T
 
T
L
 
F
G
 
-
L
 
-
L
 
-
A
 
-
P
 
-
A
 
-
L
 
-
V
 
-
L
 
L
I
 
F
G
 
C
R
 
R
L
 
L
L
 
L
Q
 
S
G
 
G
F
 
V
S
 
G
A
 
I
G
 
G
A
 
G
E
 
S
L
 
I
G
 
P
G
 
I
V
 
V
S
 
F
V
 
S
Y
 
Y
L
 
F
A
 
S
E
 
E
M
 
F
A
 
L
T
 
A
P
 
Q
G
 
E
R
 
K
K
 
R
G
 
G
F
 
E
F
 
H
T
 
L
S
 
S
W
 
W
Q
 
L
S
 
C
A
 
M
S
 
F
Q
x
W
Q
 
M
V
 
I
A
 
G
I
 
G
V
 
V
V
 
Y
A
 
A
A
 
A
A
 
A
L
 
M
G
 
A
F
 
W
A
 
A
L
 
I
N
 
-
Q
 
-
S
 
-
M
 
-
S
 
-
A
 
-
A
 
-
T
 
-
I
 
I
A
 
P
S
 
H
W
 
Y
G
 
G
W
 
W

Sites not aligning to the query:

8jlcA Synaptic vesicle glycoprotein 2A
29% identity, 28% coverage: 72:191/432 of query aligns to 81:184/592 of 8jlcA

query
sites
8jlcA
L
 
V
G
 
G
A
 
A
I
 
F
V
 
L
L
 
W
G
 
G
A
 
G
Y
 
L
I
 
A
D
 
D
D
 
R
V
 
L
G
 
G
R
 
R
R
 
R
K
 
Q
G
 
C
L
 
L
I
 
L
V
 
I
T
 
S
L
 
L
S
 
S
I
 
V
M
 
N
A
 
S
S
 
V
G
 
F
T
 
A
I
 
F
L
 
F
I
 
S
A
 
S
F
 
F
V
 
V
P
 
Q
G
 
G
Y
 
Y
A
 
G
T
 
T
L
 
F
G
 
-
L
 
-
L
 
-
A
 
-
P
 
-
A
 
-
L
 
-
V
 
-
L
 
L
I
 
F
G
 
C
R
 
R
L
 
L
L
 
L
Q
 
S
G
 
G
F
 
V
S
 
G
A
 
I
G
 
G
A
 
G
E
 
S
L
x
I
G
 
P
G
 
I
V
 
V
S
 
F
V
 
S
Y
 
Y
L
 
F
A
 
S
E
 
E
M
 
F
A
 
L
T
 
A
P
 
Q
G
 
E
R
 
K
K
 
R
G
 
G
F
 
E
F
 
H
T
 
L
S
 
S
W
 
W
Q
 
L
S
 
C
A
 
M
S
 
F
Q
x
W
Q
 
M
V
 
I
A
 
G
I
 
G
V
 
V
V
 
Y
A
 
A
A
 
A
A
 
A
L
 
M
G
 
A
F
 
W
A
 
A
L
 
I
N
 
-
Q
 
-
S
 
-
M
 
-
S
 
-
A
 
-
A
 
-
T
 
-
I
 
I
A
 
P
S
 
H
W
 
Y
G
 
G
W
 
W

Sites not aligning to the query:

Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
28% identity, 28% coverage: 72:191/432 of query aligns to 203:306/727 of Q9Z2I6

query
sites
Q9Z2I6
L
 
V
G
 
G
A
 
A
I
 
F
V
 
F
L
 
W
G
 
G
A
 
G
Y
 
L
I
 
A
D
 
D
D
 
K
V
 
V
G
 
G
R
 
R
R
 
K
K
 
Q
G
 
S
L
 
L
I
 
L
V
 
I
T
 
C
L
 
M
S
 
S
I
 
V
M
 
N
A
 
G
S
 
F
G
 
F
T
 
A
I
 
F
L
 
L
I
 
S
A
 
S
F
 
F
V
 
V
P
 
Q
G
 
G
Y
 
Y
A
 
G
T
 
-
L
 
-
G
 
-
L
 
-
L
 
-
A
 
-
P
 
-
A
 
-
L
 
F
V
 
F
L
 
L
I
 
L
G
 
C
R
 
R
L
 
L
L
 
L
Q
 
S
G
 
G
F
 
F
S
 
G
A
 
I
G
 
G
A
 
G
E
 
A
L
 
I
G
 
P
G
 
T
V
 
V
S
 
F
V
 
S
Y
 
Y
L
 
F
A
 
A
E
 
E
M
 
V
A
 
L
T
 
A
P
 
R
G
 
E
R
 
K
K
 
R
G
 
G
F
 
E
F
 
H
T
 
L
S
 
S
W
 
W
Q
 
L
S
 
C
A
 
M
S
 
F
Q
 
W
Q
 
M
V
 
I
A
 
G
I
 
G
V
 
I
V
 
Y
A
 
A
A
 
S
A
 
A
L
 
M
G
 
A
F
 
W
A
 
A
L
 
I
N
 
-
Q
 
-
S
 
-
M
 
-
S
 
-
A
 
-
A
 
-
T
 
-
I
 
I
A
 
P
S
 
H
W
 
Y
G
 
G
W
 
W

Sites not aligning to the query:

4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
22% identity, 58% coverage: 122:373/432 of query aligns to 126:407/475 of 4gc0A

query
sites
4gc0A
L
 
V
I
 
I
G
 
Y
R
 
R
L
 
I
L
 
I
Q
 
G
G
 
G
F
 
I
S
 
G
A
 
V
G
 
G
A
 
L
E
 
A
L
 
S
G
 
M
G
 
L
V
 
S
S
 
P
V
 
M
Y
 
Y
L
 
I
A
 
A
E
 
E
M
 
L
A
 
A
T
 
P
P
 
A
G
 
H
R
 
I
K
 
R
G
 
G
F
 
K
F
 
L
T
 
V
S
 
S
W
 
F
Q
 
N
S
 
-
A
 
-
S
 
-
Q
 
-
Q
|
Q
V
 
F
A
 
A
I
 
I
V
 
I
V
 
F
A
 
G
A
 
Q
A
 
L
L
 
L
G
 
V
F
 
Y
A
 
C
L
 
V
N
 
N
Q
 
Y
S
 
F
M
 
I
S
 
A
A
 
R
A
 
S
T
 
G
I
 
D
A
 
A
S
 
S
W
 
W
-
 
L
-
 
N
-
 
T
-
 
D
G
 
G
W
 
W
R
 
R
V
 
Y
P
 
M
F
 
F
F
 
A
V
 
S
G
 
E
C
 
C
M
 
I
I
 
P
V
 
A
P
 
L
F
 
L
I
 
F
F
 
L
M
 
M
L
 
L
R
 
L
R
 
Y
N
 
T
L
 
V
Q
 
P
E
 
E
T
 
S
E
 
P
E
 
R
F
 
W
-
 
L
K
 
M
A
 
S
R
 
R
Q
 
G
H
 
K
R
 
Q
P
 
E
S
 
Q
M
 
A
K
 
E
E
 
G
V
 
I
F
 
L
R
 
R
T
 
K
L
 
I
V
 
M
Q
 
G
N
 
N
-
 
T
-
 
L
-
 
A
-
 
T
-
 
Q
-
 
A
-
 
V
-
 
Q
-
 
E
-
 
I
-
 
K
-
 
H
-
 
S
-
 
L
-
 
D
-
 
H
-
 
G
-
 
R
-
 
K
-
 
T
-
 
G
-
 
G
-
 
R
-
 
L
-
 
L
-
 
M
-
 
F
-
 
G
-
 
V
W
 
G
T
 
V
V
 
I
V
 
V
I
 
I
A
 
G
G
 
V
M
 
M
M
 
L
L
 
S
V
 
I
A
 
F
M
x
Q
T
 
Q
T
 
F
A
 
V
S
 
G
F
 
I
Y
x
N
L
 
V
I
 
V
T
x
L
V
 
Y
Y
 
Y
A
 
A
P
 
P
T
 
E
F
 
V
G
 
F
K
 
K
T
 
T
V
 
-
L
 
L
H
 
G
L
 
A
S
 
S
T
 
T
A
 
D
D
 
I
S
 
A
L
 
L
L
 
L
V
 
Q
T
 
T
L
 
I
C
 
I
V
 
V
A
 
G
V
 
V
S
 
I
N
 
N
F
 
L
V
 
T
W
 
F
L
 
T
P
 
V
I
 
L
G
 
A
G
 
I
A
 
M
L
 
T
S
 
V
D
 
D
K
 
K
L
 
F
G
 
G
R
 
R
R
 
K
P
 
P
L
 
L
-
 
Q
L
 
I
V
 
I
A
 
G
M
 
A
T
 
L
V
 
G
L
 
M
A
 
A
I
 
I
A
 
G
T
 
M
A
 
F
Y
 
S
P
 
L
A
 
G
L
 
T
S
 
A
L
 
F
L
 
Y
A
 
T
H
 
Q
A
 
A
P
 
P
S
 
G
F
 
I
L
 
V
N
 
A
M
 
L
L
 
L
L
 
S
A
 
M
L
 
L
L
 
F
W
 
Y
L
 
V
S
 
A
F
 
A
M
 
F
Y
 
A
G
 
M
I
 
S
Y
 
W
N
 
G
G
 
P
A
 
V
M
 
C
V
x
W
V
 
V
A
 
L
L
 
L
T
 
S
E
 
E
V
 
I
M
 
F
P
 
P
A
 
N
Q
 
A
V
 
I
R
 
R
V
 
G
A
 
K
G
 
A
F
 
L
S
 
A
L
 
I
A
 
A

4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
22% identity, 58% coverage: 122:373/432 of query aligns to 126:407/475 of 4gbzA

query
sites
4gbzA
L
 
V
I
 
I
G
 
Y
R
 
R
L
 
I
L
 
I
Q
 
G
G
 
G
F
 
I
S
 
G
A
 
V
G
 
G
A
 
L
E
 
A
L
 
S
G
 
M
G
 
L
V
 
S
S
 
P
V
 
M
Y
 
Y
L
 
I
A
 
A
E
 
E
M
 
L
A
 
A
T
 
P
P
 
A
G
 
H
R
 
I
K
 
R
G
 
G
F
 
K
F
 
L
T
 
V
S
 
S
W
 
F
Q
 
N
S
 
-
A
 
-
S
 
-
Q
 
-
Q
|
Q
V
 
F
A
 
A
I
 
I
V
 
I
V
 
F
A
 
G
A
 
Q
A
 
L
L
 
L
G
 
V
F
 
Y
A
 
C
L
 
V
N
 
N
Q
 
Y
S
 
F
M
 
I
S
 
A
A
 
R
A
 
S
T
 
G
I
 
D
A
 
A
S
 
S
W
 
W
-
 
L
-
 
N
-
 
T
-
 
D
G
 
G
W
 
W
R
 
R
V
 
Y
P
 
M
F
 
F
F
 
A
V
 
S
G
 
E
C
 
C
M
 
I
I
 
P
V
 
A
P
 
L
F
 
L
I
 
F
F
 
L
M
 
M
L
 
L
R
 
L
R
 
Y
N
 
T
L
 
V
Q
 
P
E
 
E
T
 
S
E
 
P
E
 
R
F
 
W
-
 
L
K
 
M
A
 
S
R
 
R
Q
 
G
H
 
K
R
 
Q
P
 
E
S
 
Q
M
 
A
K
 
E
E
 
G
V
 
I
F
 
L
R
 
R
T
 
K
L
 
I
V
 
M
Q
 
G
N
 
N
-
 
T
-
 
L
-
 
A
-
 
T
-
 
Q
-
 
A
-
 
V
-
 
Q
-
 
E
-
 
I
-
 
K
-
 
H
-
 
S
-
 
L
-
 
D
-
 
H
-
 
G
-
 
R
-
 
K
-
 
T
-
 
G
-
 
G
-
 
R
-
 
L
-
 
L
-
 
M
-
 
F
-
 
G
-
 
V
W
 
G
T
 
V
V
 
I
V
 
V
I
 
I
A
 
G
G
 
V
M
 
M
M
 
L
L
 
S
V
 
I
A
 
F
M
x
Q
T
 
Q
T
 
F
A
 
V
S
 
G
F
 
I
Y
x
N
L
 
V
I
 
V
T
 
L
V
 
Y
Y
 
Y
A
 
A
P
 
P
T
 
E
F
 
V
G
 
F
K
 
K
T
 
T
V
 
-
L
 
L
H
 
G
L
 
A
S
 
S
T
 
T
A
 
D
D
 
I
S
 
A
L
 
L
L
 
L
V
 
Q
T
 
T
L
 
I
C
 
I
V
 
V
A
 
G
V
 
V
S
 
I
N
 
N
F
 
L
V
 
T
W
 
F
L
 
T
P
 
V
I
 
L
G
 
A
G
 
I
A
 
M
L
 
T
S
 
V
D
 
D
K
 
K
L
 
F
G
 
G
R
 
R
R
 
K
P
 
P
L
 
L
-
 
Q
L
 
I
V
 
I
A
 
G
M
 
A
T
 
L
V
 
G
L
 
M
A
 
A
I
 
I
A
 
G
T
 
M
A
 
F
Y
 
S
P
 
L
A
 
G
L
 
T
S
 
A
L
 
F
L
 
Y
A
 
T
H
 
Q
A
 
A
P
 
P
S
 
G
F
 
I
L
 
V
N
 
A
M
 
L
L
 
L
L
 
S
A
 
M
L
 
L
L
 
F
W
 
Y
L
 
V
S
 
A
F
 
A
M
 
F
Y
 
A
G
 
M
I
 
S
Y
 
W
N
 
G
G
 
P
A
 
V
M
 
C
V
x
W
V
 
V
A
 
L
L
 
L
T
 
S
E
 
E
V
 
I
M
 
F
P
 
P
A
 
N
Q
 
A
V
 
I
R
 
R
V
 
G
A
 
K
G
 
A
F
 
L
S
 
A
L
 
I
A
 
A

4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
22% identity, 58% coverage: 122:373/432 of query aligns to 126:407/475 of 4gbyA

query
sites
4gbyA
L
 
V
I
 
I
G
 
Y
R
 
R
L
 
I
L
 
I
Q
 
G
G
 
G
F
 
I
S
 
G
A
 
V
G
 
G
A
 
L
E
 
A
L
 
S
G
 
M
G
 
L
V
 
S
S
 
P
V
 
M
Y
 
Y
L
 
I
A
 
A
E
 
E
M
 
L
A
 
A
T
 
P
P
 
A
G
 
H
R
 
I
K
 
R
G
 
G
F
 
K
F
 
L
T
 
V
S
 
S
W
 
F
Q
 
N
S
 
-
A
 
-
S
 
-
Q
 
-
Q
|
Q
V
 
F
A
 
A
I
 
I
V
 
I
V
 
F
A
 
G
A
 
Q
A
 
L
L
 
L
G
 
V
F
 
Y
A
 
C
L
 
V
N
 
N
Q
 
Y
S
 
F
M
 
I
S
 
A
A
 
R
A
 
S
T
 
G
I
 
D
A
 
A
S
 
S
W
 
W
-
 
L
-
 
N
-
 
T
-
 
D
G
 
G
W
 
W
R
 
R
V
 
Y
P
 
M
F
 
F
F
 
A
V
 
S
G
 
E
C
 
C
M
 
I
I
 
P
V
 
A
P
 
L
F
 
L
I
 
F
F
 
L
M
 
M
L
 
L
R
 
L
R
 
Y
N
 
T
L
 
V
Q
 
P
E
 
E
T
 
S
E
 
P
E
 
R
F
 
W
-
 
L
K
 
M
A
 
S
R
 
R
Q
 
G
H
 
K
R
 
Q
P
 
E
S
 
Q
M
 
A
K
 
E
E
 
G
V
 
I
F
 
L
R
 
R
T
 
K
L
 
I
V
 
M
Q
 
G
N
 
N
-
 
T
-
 
L
-
 
A
-
 
T
-
 
Q
-
 
A
-
 
V
-
 
Q
-
 
E
-
 
I
-
 
K
-
 
H
-
 
S
-
 
L
-
 
D
-
 
H
-
 
G
-
 
R
-
 
K
-
 
T
-
 
G
-
 
G
-
 
R
-
 
L
-
 
L
-
 
M
-
 
F
-
 
G
-
 
V
W
 
G
T
 
V
V
 
I
V
 
V
I
 
I
A
 
G
G
 
V
M
 
M
M
 
L
L
 
S
V
 
I
A
 
F
M
x
Q
T
 
Q
T
 
F
A
 
V
S
 
G
F
 
I
Y
x
N
L
 
V
I
 
V
T
 
L
V
 
Y
Y
 
Y
A
 
A
P
 
P
T
 
E
F
 
V
G
 
F
K
 
K
T
 
T
V
 
-
L
 
L
H
 
G
L
 
A
S
 
S
T
 
T
A
 
D
D
 
I
S
 
A
L
 
L
L
 
L
V
 
Q
T
 
T
L
 
I
C
 
I
V
 
V
A
 
G
V
 
V
S
 
I
N
 
N
F
 
L
V
 
T
W
 
F
L
 
T
P
 
V
I
 
L
G
 
A
G
 
I
A
 
M
L
 
T
S
 
V
D
 
D
K
 
K
L
 
F
G
 
G
R
 
R
R
 
K
P
 
P
L
 
L
-
 
Q
L
 
I
V
 
I
A
 
G
M
 
A
T
 
L
V
 
G
L
 
M
A
 
A
I
 
I
A
 
G
T
 
M
A
 
F
Y
 
S
P
 
L
A
 
G
L
 
T
S
 
A
L
 
F
L
 
Y
A
 
T
H
 
Q
A
 
A
P
 
P
S
 
G
F
 
I
L
 
V
N
 
A
M
 
L
L
 
L
L
 
S
A
 
M
L
 
L
L
 
F
W
 
Y
L
 
V
S
 
A
F
 
A
M
 
F
Y
 
A
G
 
M
I
 
S
Y
 
W
N
 
G
G
 
P
A
 
V
M
 
C
V
x
W
V
 
V
A
 
L
L
 
L
T
 
S
E
 
E
V
 
I
M
 
F
P
 
P
A
 
N
Q
 
A
V
 
I
R
 
R
V
 
G
A
 
K
G
 
A
F
 
L
S
 
A
L
 
I
A
 
A

P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
22% identity, 58% coverage: 122:373/432 of query aligns to 130:411/491 of P0AGF4

query
sites
P0AGF4
L
 
V
I
 
I
G
 
Y
R
|
R
L
 
I
L
 
I
Q
 
G
G
 
G
F
 
I
S
 
G
A
 
V
G
 
G
A
 
L
E
 
A
L
 
S
G
 
M
G
 
L
V
 
S
S
 
P
V
 
M
Y
 
Y
L
 
I
A
 
A
E
|
E
M
 
L
A
 
A
T
 
P
P
 
A
G
 
H
R
 
I
K
x
R
G
 
G
F
 
K
F
 
L
T
 
V
S
 
S
W
 
F
Q
 
N
S
 
-
A
 
-
S
 
-
Q
 
-
Q
|
Q
V
 
F
A
 
A
I
 
I
V
 
I
V
 
F
A
 
G
A
 
Q
A
 
L
L
 
L
G
 
V
F
 
Y
A
 
C
L
 
V
N
 
N
Q
 
Y
S
 
F
M
 
I
S
 
A
A
 
R
A
 
S
T
 
G
I
 
D
A
 
A
S
 
S
W
 
W
-
 
L
-
 
N
-
 
T
-
 
D
G
 
G
W
 
W
R
 
R
V
 
Y
P
 
M
F
 
F
F
 
A
V
 
S
G
 
E
C
 
C
M
 
I
I
 
P
V
 
A
P
 
L
F
 
L
I
 
F
F
 
L
M
 
M
L
 
L
R
 
L
R
 
Y
N
 
T
L
 
V
Q
 
P
E
 
E
T
 
S
E
 
P
E
 
R
F
 
W
-
 
L
K
 
M
A
 
S
R
 
R
Q
 
G
H
 
K
R
 
Q
P
 
E
S
 
Q
M
 
A
K
 
E
E
 
G
V
 
I
F
 
L
R
 
R
T
 
K
L
 
I
V
 
M
Q
 
G
N
 
N
-
 
T
-
 
L
-
 
A
-
 
T
-
 
Q
-
 
A
-
 
V
-
 
Q
-
 
E
-
 
I
-
 
K
-
 
H
-
 
S
-
 
L
-
 
D
-
 
H
-
 
G
-
 
R
-
 
K
-
 
T
-
 
G
-
 
G
-
 
R
-
 
L
-
 
L
-
 
M
-
 
F
-
 
G
-
 
V
W
 
G
T
 
V
V
 
I
V
 
V
I
 
I
A
 
G
G
 
V
M
 
M
M
 
L
L
 
S
V
 
I
A
 
F
M
x
Q
T
x
Q
T
 
F
A
 
V
S
 
G
F
 
I
Y
x
N
L
 
V
I
 
V
T
 
L
V
x
Y
Y
 
Y
A
 
A
P
 
P
T
 
E
F
 
V
G
 
F
K
 
K
T
 
T
V
 
-
L
 
L
H
 
G
L
 
A
S
 
S
T
 
T
A
 
D
D
 
I
S
 
A
L
 
L
L
 
L
V
 
Q
T
 
T
L
 
I
C
 
I
V
 
V
A
 
G
V
 
V
S
 
I
N
|
N
F
 
L
V
 
T
W
 
F
L
 
T
P
 
V
I
 
L
G
 
A
G
 
I
A
 
M
L
 
T
S
 
V
D
 
D
K
 
K
L
 
F
G
|
G
R
|
R
R
 
K
P
 
P
L
 
L
-
 
Q
L
 
I
V
 
I
A
 
G
M
 
A
T
 
L
V
 
G
L
 
M
A
 
A
I
 
I
A
 
G
T
 
M
A
 
F
Y
 
S
P
 
L
A
 
G
L
 
T
S
 
A
L
 
F
L
 
Y
A
 
T
H
 
Q
A
 
A
P
 
P
S
 
G
F
 
I
L
 
V
N
 
A
M
 
L
L
 
L
L
 
S
A
 
M
L
 
L
L
 
F
W
 
Y
L
 
V
S
 
A
F
 
A
M
 
F
Y
 
A
G
 
M
I
 
S
Y
 
W
N
 
G
G
 
P
A
 
V
M
 
C
V
x
W
V
 
V
A
 
L
L
 
L
T
 
S
E
|
E
V
 
I
M
 
F
P
 
P
A
 
N
Q
 
A
V
 
I
R
|
R
V
 
G
A
 
K
G
 
A
F
 
L
S
 
A
L
 
I
A
 
A

Sites not aligning to the query:

Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
28% identity, 28% coverage: 72:191/432 of query aligns to 203:306/727 of Q496J9

query
sites
Q496J9
L
 
V
G
 
G
A
 
A
I
 
F
V
 
F
L
 
W
G
 
G
A
 
G
Y
 
L
I
 
A
D
 
D
D
 
K
V
 
V
G
 
G
R
 
R
R
 
K
K
 
Q
G
 
S
L
 
L
I
 
L
V
 
I
T
 
C
L
 
M
S
 
S
I
 
V
M
 
N
A
 
G
S
 
F
G
 
F
T
 
A
I
 
F
L
 
L
I
 
S
A
 
S
F
 
F
V
 
V
P
 
Q
G
 
G
Y
 
Y
A
 
-
T
 
-
L
 
-
G
 
-
L
 
-
L
 
-
A
 
-
P
 
-
A
 
G
L
 
F
V
 
F
L
 
L
I
 
F
G
 
C
R
 
R
L
 
L
L
 
L
Q
 
S
G
 
G
F
 
F
S
 
G
A
 
I
G
 
G
A
 
G
E
 
A
L
 
I
G
 
P
G
 
T
V
 
V
S
 
F
V
 
S
Y
 
Y
L
 
F
A
 
A
E
 
E
M
 
V
A
 
L
T
 
A
P
 
R
G
 
E
R
 
K
K
 
R
G
 
G
F
 
E
F
 
H
T
 
L
S
 
S
W
 
W
Q
 
L
S
 
C
A
 
M
S
 
F
Q
 
W
Q
 
M
V
 
I
A
 
G
I
 
G
V
 
I
V
 
Y
A
 
A
A
 
S
A
 
A
L
 
M
G
 
A
F
 
W
A
 
A
L
 
I
N
 
-
Q
 
-
S
 
-
M
 
-
S
 
-
A
 
-
A
 
-
T
 
-
I
 
I
A
 
P
S
 
H
W
 
Y
G
 
G
W
 
W

Sites not aligning to the query:

Q02563 Synaptic vesicle glycoprotein 2A; Synaptic vesicle protein 2; Synaptic vesicle protein 2A from Rattus norvegicus (Rat) (see 2 papers)
29% identity, 28% coverage: 72:191/432 of query aligns to 217:320/742 of Q02563

query
sites
Q02563
L
 
V
G
 
G
A
 
A
I
 
F
V
 
L
L
 
W
G
 
G
A
 
G
Y
 
L
I
 
A
D
 
D
D
 
R
V
 
L
G
 
G
R
 
R
R
 
R
K
 
Q
G
 
C
L
 
L
I
 
L
V
 
I
T
 
S
L
 
L
S
 
S
I
 
V
M
 
N
A
 
S
S
 
V
G
 
F
T
 
A
I
 
F
L
 
F
I
 
S
A
 
S
F
 
F
V
 
V
P
 
Q
G
 
G
Y
 
Y
A
 
G
T
 
T
L
 
F
G
 
-
L
 
-
L
 
-
A
 
-
P
 
-
A
 
-
L
 
-
V
 
-
L
 
L
I
 
F
G
 
C
R
 
R
L
 
L
L
 
L
Q
 
S
G
 
G
F
 
V
S
 
G
A
 
I
G
 
G
A
 
G
E
 
S
L
 
I
G
 
P
G
 
I
V
 
V
S
 
F
V
 
S
Y
 
Y
L
 
F
A
 
S
E
 
E
M
 
F
A
 
L
T
 
A
P
 
Q
G
 
E
R
 
K
K
 
R
G
 
G
F
 
E
F
 
H
T
 
L
S
 
S
W
 
W
Q
 
L
S
 
C
A
 
M
S
 
F
Q
 
W
Q
 
M
V
 
I
A
 
G
I
 
G
V
 
V
V
 
Y
A
 
A
A
 
A
A
 
A
L
 
M
G
 
A
F
 
W
A
 
A
L
 
I
N
 
-
Q
 
-
S
 
-
M
 
-
S
 
-
A
 
-
A
 
-
T
 
-
I
 
I
A
 
P
S
 
H
W
 
Y
G
 
G
W
 
W

Sites not aligning to the query:

Query Sequence

>H281DRAFT_03338 FitnessBrowser__Burk376:H281DRAFT_03338
MHPSPSTLSSGRSKAAAVFRVTAGNFLEQFDFFLFGFYATQIAKVFFPADSEFASLMMTF
AVFGAGFLMRPLGAIVLGAYIDDVGRRKGLIVTLSIMASGTILIAFVPGYATLGLLAPAL
VLIGRLLQGFSAGAELGGVSVYLAEMATPGRKGFFTSWQSASQQVAIVVAAALGFALNQS
MSAATIASWGWRVPFFVGCMIVPFIFMLRRNLQETEEFKARQHRPSMKEVFRTLVQNWTV
VIAGMMLVAMTTASFYLITVYAPTFGKTVLHLSTADSLLVTLCVAVSNFVWLPIGGALSD
KLGRRPLLVAMTVLAIATAYPALSLLAHAPSFLNMLLALLWLSFMYGIYNGAMVVALTEV
MPAQVRVAGFSLAYSLATAVFGGFTPAISTALIHMTGDKAAPGYWMSFAAACALMATFAL
YRRRATTLTPAH

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory