Comparing H281DRAFT_03359 FitnessBrowser__Burk376:H281DRAFT_03359 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4oanA Crystal structure of a trap periplasmic solute binding protein from rhodopseudomonas palustris haa2 (rpb_2686), target efi-510221, with density modeled as (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2- acetolactate) (see paper)
63% identity, 90% coverage: 35:342/342 of query aligns to 5:312/312 of 4oanA
4mnpA Structure of the sialic acid binding protein from fusobacterium nucleatum subsp. Nucleatum atcc 25586 (see paper)
33% identity, 79% coverage: 59:327/342 of query aligns to 24:290/305 of 4mnpA
P44542 Sialic acid-binding periplasmic protein SiaP; Extracytoplasmic solute receptor protein SiaP; N-acetylneuraminic-binding protein; Neu5Ac-binding protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
30% identity, 88% coverage: 35:336/342 of query aligns to 24:323/329 of P44542
3b50A Structure of h. Influenzae sialic acid binding protein bound to neu5ac. (see paper)
30% identity, 88% coverage: 35:336/342 of query aligns to 1:300/310 of 3b50A
2v4cA Structure of sialic acid binding protein (siap) in the presence of kdn (see paper)
30% identity, 88% coverage: 35:336/342 of query aligns to 1:300/309 of 2v4cA
2wx9A Crystal structure of the sialic acid binding periplasmic protein siap (see paper)
30% identity, 88% coverage: 35:336/342 of query aligns to 1:300/308 of 2wx9A
2cexA Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
30% identity, 88% coverage: 37:336/342 of query aligns to 2:299/304 of 2cexA
Sites not aligning to the query:
2cexB Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
30% identity, 88% coverage: 37:336/342 of query aligns to 2:299/305 of 2cexB
Sites not aligning to the query:
2xwoA Siap r147e mutant in complex with sialylamide (see paper)
30% identity, 88% coverage: 35:336/342 of query aligns to 1:300/308 of 2xwoA
4mmpA Structure of sialic acid binding protein from pasturella multocida (see paper)
33% identity, 81% coverage: 59:336/342 of query aligns to 26:301/308 of 4mmpA
Sites not aligning to the query:
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
31% identity, 81% coverage: 59:335/342 of query aligns to 24:298/303 of 4pddA
Sites not aligning to the query:
Q16BC9 Solute-binding protein RD1_1052 from Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans) (see paper)
34% identity, 70% coverage: 66:305/342 of query aligns to 58:295/325 of Q16BC9
4pcdA Crystal structure of a trap periplasmic solute binding protein from roseobacter denitrificans och 114 (rd1_1052, target efi-510238) with bound l-galactonate (see paper)
34% identity, 70% coverage: 66:305/342 of query aligns to 34:271/300 of 4pcdA
4pc9A Crystal structure of a trap periplasmic solute binding protein from rosenbacter denitrificans och 114 (rd1_1052, target efi-510238) with bound d-mannonate (see paper)
34% identity, 70% coverage: 66:305/342 of query aligns to 34:271/300 of 4pc9A
Sites not aligning to the query:
7a5qB Crystal structure of vcsiap bound to sialic acid (see paper)
33% identity, 76% coverage: 55:314/342 of query aligns to 20:278/299 of 7a5qB
Sites not aligning to the query:
7a5qA Crystal structure of vcsiap bound to sialic acid (see paper)
33% identity, 76% coverage: 55:314/342 of query aligns to 20:278/299 of 7a5qA
Sites not aligning to the query:
4magA Crystal structure of the periplasmic sialic acid binding protein from vibrio cholerea (see paper)
33% identity, 76% coverage: 55:314/342 of query aligns to 20:278/307 of 4magA
Sites not aligning to the query:
4xeqB Crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid
33% identity, 77% coverage: 53:314/342 of query aligns to 18:278/304 of 4xeqB
Sites not aligning to the query:
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
31% identity, 88% coverage: 29:330/342 of query aligns to 1:296/304 of 4pakA
4nq8B Crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate (see paper)
31% identity, 85% coverage: 36:326/342 of query aligns to 1:288/301 of 4nq8B
>H281DRAFT_03359 FitnessBrowser__Burk376:H281DRAFT_03359
MSSYSRRTFLQTLGAAAVATTGTGLFPSLACAQTAQFKLKYANNLALSHPLNVRAKEAAD
AIRKETGGRVDLQIFPNGQMGTDTDMLSQVRSGAIDFLTQGGVVLSTLVPVSAINGIGFA
FKDYNQVWAAMDGDLGSYIRRAVSKVGLIAMEKPWDNGFRHLTSSVKPVLSPTDLKGLKI
RVPVSPLWTSMFKALDASPTSINFSEAYSALQTKVVDAEENPLALIETGRFYEVQKYCSL
TGHIWDGFWFLANARSWGNLPPDLQTIVAKHLNAAAVAERADVAALSTSLVETLRSHGMA
FNKPDIQPFRASLQKAGFYDQWRKKYGDEAWALLEKYTQKLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory