Comparing H281DRAFT_03378 FitnessBrowser__Burk376:H281DRAFT_03378 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
72% identity, 92% coverage: 26:315/315 of query aligns to 1:290/290 of 4wutA
4rxtA Crystal structure of carbohydrate transporter solute binding protein arad_9553 from agrobacterium radiobacter, target efi-511541, in complex with d-arabinose
35% identity, 88% coverage: 28:305/315 of query aligns to 7:285/295 of 4rxtA
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
33% identity, 89% coverage: 28:307/315 of query aligns to 4:291/313 of 2h3hA
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
32% identity, 90% coverage: 28:311/315 of query aligns to 4:295/305 of 3c6qC
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
31% identity, 75% coverage: 27:262/315 of query aligns to 4:241/287 of 5dteB
Sites not aligning to the query:
5xssA Xylfii molecule (see paper)
29% identity, 86% coverage: 27:298/315 of query aligns to 5:269/274 of 5xssA
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
29% identity, 89% coverage: 27:306/315 of query aligns to 10:280/284 of 7e7mC
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
30% identity, 88% coverage: 28:303/315 of query aligns to 4:271/271 of 1dbpA
5dkvA Crystal structure of an abc transporter solute binding protein from agrobacterium vitis(avis_5339, target efi-511225) bound with alpha-d- tagatopyranose
26% identity, 92% coverage: 27:315/315 of query aligns to 8:301/303 of 5dkvA
6guqA Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with glucose
27% identity, 86% coverage: 36:305/315 of query aligns to 12:276/278 of 6guqA
Sites not aligning to the query:
6gt9A Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with galactose
27% identity, 86% coverage: 36:305/315 of query aligns to 17:281/283 of 6gt9A
Sites not aligning to the query:
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
28% identity, 85% coverage: 27:295/315 of query aligns to 3:283/288 of 1rpjA
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
28% identity, 85% coverage: 27:295/315 of query aligns to 3:283/288 of 1gudA
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
30% identity, 89% coverage: 28:307/315 of query aligns to 9:286/289 of 5hqjA
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
24% identity, 88% coverage: 28:305/315 of query aligns to 3:273/274 of 2ioyA
3ksmA Crystal structure of abc-type sugar transport system, periplasmic component from hahella chejuensis
27% identity, 88% coverage: 27:302/315 of query aligns to 2:276/276 of 3ksmA
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
27% identity, 85% coverage: 27:295/315 of query aligns to 3:283/288 of 8wlbA
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
27% identity, 85% coverage: 27:295/315 of query aligns to 3:283/288 of 8wl9A
5ibqA Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
28% identity, 73% coverage: 76:306/315 of query aligns to 50:269/287 of 5ibqA
Sites not aligning to the query:
4ry0A Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
28% identity, 73% coverage: 76:306/315 of query aligns to 50:269/287 of 4ry0A
Sites not aligning to the query:
>H281DRAFT_03378 FitnessBrowser__Burk376:H281DRAFT_03378
MKKVSVLAAAAAMCAMFSAYAQAAGGEIAVIVKTANSNYWQNVQKGATAAMADAKGYTMT
FQGPAAESAIADEVNMVENAVNRHVAGIVLAPSDPDALVPAMKKAWEAHIPVVLIDSTVS
DAGKQYYQSFLSTDNVKAGELCAKAMIDRVGQTGKVAVMSYVPGAGSEVGRVGGFRKYIA
AHSKLQLVGPFYSQSQMANALNQTTDVLSANPDLKGIFGANEPTAVGMGRALQQSGKGGK
VIAIGFDGNQDLQGFVRDGTIQAIAVQSSYQMGYKGIQTLVNVIERKPVSKQVDTGVMMV
EKQNLDSSEAKNVLY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory