SitesBLAST
Comparing H281DRAFT_03529 FitnessBrowser__Burk376:H281DRAFT_03529 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
D4A1J4 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Rattus norvegicus (Rat) (see paper)
58% identity, 98% coverage: 4:246/247 of query aligns to 3:244/245 of D4A1J4
- Y147 (= Y144) mutation to F: Loss of function.
Q8JZV9 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Mus musculus (Mouse) (see paper)
57% identity, 98% coverage: 4:246/247 of query aligns to 3:244/245 of Q8JZV9
- Y147 (= Y144) active site, Proton acceptor; mutation to F: Loss of function.
Q9BUT1 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Homo sapiens (Human) (see 4 papers)
57% identity, 98% coverage: 4:246/247 of query aligns to 3:244/245 of Q9BUT1
2ag5A Crystal structure of human dhrs6 (see paper)
57% identity, 98% coverage: 4:246/247 of query aligns to 3:244/246 of 2ag5A
- active site: S133 (= S130), Y147 (= Y144), K151 (= K148), R192 (≠ Q189)
- binding nicotinamide-adenine-dinucleotide: Q16 (= Q17), G17 (= G18), I18 (= I19), D37 (= D38), I38 (= I39), D58 (= D55), V59 (= V56), V81 (≠ C78), G83 (= G80), L104 (= L101), Y147 (= Y144), K151 (= K148), P177 (= P174), V180 (= V177), T182 (≠ S179), S184 (= S181)
- binding sulfate ion: R144 (= R141), R188 (= R185), F202 (= F204), R205 (= R207)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
37% identity, 99% coverage: 4:247/247 of query aligns to 3:248/249 of 4bmsF
- active site: S137 (≠ A131), H147 (≠ R141), Y150 (= Y144), K154 (= K148), Q195 (= Q189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (≠ A14), N15 (≠ G16), S16 (≠ Q17), I18 (= I19), R38 (≠ I39), R39 (= R40), A59 (≠ L54), D60 (= D55), V61 (= V56), N87 (≠ C78), S88 (≠ A79), G89 (= G80), V110 (≠ L101), S137 (≠ A131), Y150 (= Y144), K154 (= K148), G181 (= G175), I183 (≠ V177), T185 (≠ S179), I187 (≠ S181)
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
38% identity, 99% coverage: 4:247/247 of query aligns to 3:248/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (≠ A131), H147 (≠ R141), Y150 (= Y144), L188 (= L182), L246 (≠ W245)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (≠ A14), N15 (≠ G16), S16 (≠ Q17), G17 (= G18), I18 (= I19), R38 (≠ I39), R39 (= R40), D60 (= D55), V61 (= V56), N87 (≠ C78), S88 (≠ A79), G89 (= G80), V110 (≠ L101), T135 (≠ S129), S137 (≠ A131), Y150 (= Y144), K154 (= K148), P180 (= P174), G181 (= G175), A182 (≠ T176), I183 (≠ V177), T185 (≠ S179), S187 (= S181)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
34% identity, 98% coverage: 5:246/247 of query aligns to 3:246/248 of 6ixmC
- active site: G16 (= G18), S142 (= S130), Y155 (= Y144), K159 (= K148)
- binding nicotinamide-adenine-dinucleotide: G12 (≠ A14), S15 (≠ Q17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (= I39), A61 (≠ L54), D62 (= D55), T63 (≠ V56), N89 (≠ C78), A90 (= A79), M140 (= M128), S142 (= S130), Y155 (= Y144), K159 (= K148), P185 (= P174), A186 (≠ G175), Y187 (≠ T176), I188 (≠ V177), L192 (≠ S181)
2q2qD Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida (see paper)
37% identity, 98% coverage: 5:245/247 of query aligns to 2:252/255 of 2q2qD
- active site: G15 (= G18), S138 (= S130), Y151 (= Y144), K155 (= K148), R196 (≠ Q189)
- binding nicotinamide-adenine-dinucleotide: G11 (≠ A14), T13 (≠ G16), S14 (≠ Q17), G15 (= G18), I16 (= I19), F36 (vs. gap), D59 (≠ R52), L60 (≠ K53), N86 (≠ C78), G88 (= G80), L109 (= L101), I136 (≠ M128), S138 (= S130), Y151 (= Y144), K155 (= K148), P181 (= P174), G182 (= G175), W183 (≠ T176), V184 (= V177), T186 (≠ S179), L188 (≠ S181), V189 (≠ L182)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
34% identity, 100% coverage: 1:247/247 of query aligns to 4:252/258 of 4wecA
- active site: G21 (= G18), S143 (= S130), Q154 (≠ R141), Y157 (= Y144), K161 (= K148)
- binding nicotinamide-adenine-dinucleotide: G17 (≠ A14), A19 (≠ G16), S20 (≠ Q17), G21 (= G18), I22 (= I19), D41 (= D38), I42 (= I39), V61 (≠ L54), D62 (= D55), V63 (= V56), N89 (≠ C78), T141 (≠ M128), Y157 (= Y144), K161 (= K148), P187 (= P174), P189 (≠ T176), V190 (= V177)
2dtxA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with d-mannose (see paper)
36% identity, 98% coverage: 5:246/247 of query aligns to 5:246/255 of 2dtxA
2dteA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with nadh (see paper)
36% identity, 98% coverage: 5:246/247 of query aligns to 5:246/255 of 2dteA
- active site: G18 (= G18), S132 (= S130), Y145 (= Y144), S148 (= S147), K149 (= K148)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (≠ A14), S16 (≠ G16), M17 (≠ Q17), G18 (= G18), I19 (= I19), S38 (≠ D38), I39 (= I39), C52 (≠ L54), D53 (= D55), V54 (= V56), N80 (≠ C78), A81 (= A79), I130 (≠ M128), S132 (= S130), Y145 (= Y144), K149 (= K148), P174 (= P174), A175 (≠ G175), T176 (= T176), I177 (≠ V177), T179 (≠ S179), P180 (= P180), L181 (≠ S181), V182 (≠ L182)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
35% identity, 98% coverage: 3:244/247 of query aligns to 1:236/239 of 4nbtA
- active site: G16 (= G18), S132 (= S130), Y145 (= Y144), K149 (= K148)
- binding nicotinamide-adenine-dinucleotide: G12 (≠ A14), K15 (≠ Q17), G16 (= G18), L17 (≠ I19), D36 (= D38), L37 (≠ I39), L52 (= L54), N53 (≠ D55), V54 (= V56), N80 (≠ C78), A81 (= A79), G82 (= G80), I130 (≠ M128), S132 (= S130), Y145 (= Y144), K149 (= K148), P177 (= P174), G178 (= G175), I180 (≠ V177), T182 (≠ S179)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
36% identity, 98% coverage: 4:244/247 of query aligns to 4:241/244 of 4nbuB
- active site: G18 (= G18), N111 (= N102), S139 (= S130), Q149 (≠ R141), Y152 (= Y144), K156 (= K148)
- binding acetoacetyl-coenzyme a: D93 (≠ A84), K98 (≠ E89), S139 (= S130), N146 (≠ G137), V147 (= V138), Q149 (≠ R141), Y152 (= Y144), F184 (≠ T176), M189 (≠ A192), K200 (≠ A203)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (≠ A14), N17 (≠ Q17), G18 (= G18), I19 (= I19), D38 (= D38), F39 (≠ I39), V59 (≠ L54), D60 (= D55), V61 (= V56), N87 (≠ C78), A88 (= A79), G89 (= G80), I90 (≠ F81), T137 (≠ M128), S139 (= S130), Y152 (= Y144), K156 (= K148), P182 (= P174), F184 (≠ T176), T185 (≠ A188), T187 (≠ A190), M189 (≠ A192)
2cfcA Structural basis for stereo selectivity in the (r)- and (s)-hydroxypropylethane thiosulfonate dehydrogenases (see paper)
35% identity, 97% coverage: 8:246/247 of query aligns to 3:248/250 of 2cfcA
- active site: G13 (= G18), S142 (= S130), Y155 (= Y144), K159 (= K148)
- binding (2-[2-ketopropylthio]ethanesulfonate: F149 (≠ V138), R152 (= R141), Y155 (= Y144), W195 (≠ Q184), R196 (= R185)
- binding nicotinamide-adenine-dinucleotide: G9 (≠ A14), S12 (≠ Q17), G13 (= G18), N14 (≠ I19), D33 (= D38), L34 (≠ I39), A59 (≠ K53), D60 (= D55), V61 (= V56), N87 (≠ C78), A88 (= A79), G89 (= G80), I140 (≠ M128), P185 (= P174), G186 (= G175), M187 (≠ T176), I188 (≠ V177), T190 (≠ S179), P191 (= P180), M192 (≠ S181), T193 (≠ L182)
Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase; R-HPCDH; 2-[(R)-2-hydroxypropylthio]ethanesulfonate dehydrogenase; Aliphatic epoxide carboxylation component III; Epoxide carboxylase component III; RHPCDH1; EC 1.1.1.268 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 4 papers)
35% identity, 97% coverage: 8:246/247 of query aligns to 3:248/250 of Q56840
- SGN 12:14 (≠ QGI 17:19) binding
- D33 (= D38) binding
- DV 60:61 (= DV 55:56) binding
- N87 (≠ C78) binding
- S142 (= S130) mutation to A: Retains weak activity. 120-fold decrease in kcat.; mutation to C: Loss of activity.
- R152 (= R141) binding ; mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- Y155 (= Y144) mutation Y->E,F: Loss of activity.
- K159 (= K148) mutation to A: Loss of activity.
- R179 (= R168) mutation to A: Loss of activity.
- IETPM 188:192 (≠ VSSPS 177:181) binding
- WR 195:196 (≠ QR 184:185) binding
- R196 (= R185) mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- R203 (≠ Q201) mutation to A: Slight decrease in catalytic efficiency.
- R209 (= R207) mutation to A: Does not affect catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2ztlA Closed conformation of d-3-hydroxybutyrate dehydrogenase complexed with NAD+ and l-3-hydroxybutyrate (see paper)
35% identity, 98% coverage: 5:246/247 of query aligns to 2:258/260 of 2ztlA
- active site: G15 (= G18), N114 (= N102), S142 (= S130), Y155 (= Y144), K159 (= K148), L200 (≠ Q189)
- binding (3s)-3-hydroxybutanoic acid: Q94 (≠ V82), S142 (= S130), H144 (≠ A132), K152 (≠ R141), Y155 (= Y144), Q196 (≠ R185)
- binding nicotinamide-adenine-dinucleotide: G11 (≠ A14), G15 (= G18), I16 (= I19), F36 (≠ L44), L64 (≠ V56), N90 (≠ C78), A91 (= A79), G92 (= G80), L113 (= L101), Y155 (= Y144), K159 (= K148), P185 (= P174), W187 (≠ T176), V188 (= V177), T190 (≠ S179), V193 (≠ L182)
1wmbA Crystal structure of NAD dependent d-3-hydroxybutylate dehydrogenase (see paper)
35% identity, 98% coverage: 5:246/247 of query aligns to 2:258/260 of 1wmbA
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
34% identity, 97% coverage: 5:244/247 of query aligns to 6:239/243 of 4i08A
- active site: G19 (= G18), N113 (= N102), S141 (= S130), Q151 (≠ R141), Y154 (= Y144), K158 (= K148)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (≠ A14), S17 (≠ G16), R18 (≠ Q17), I20 (= I19), T40 (≠ I39), N62 (≠ D55), V63 (= V56), N89 (≠ C78), A90 (= A79), G140 (≠ S129), S141 (= S130), Y154 (= Y144), K158 (= K148), P184 (= P174), G185 (= G175), T189 (≠ S179)
5b4tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and a substrate d-3- hydroxybutyrate (see paper)
36% identity, 98% coverage: 5:246/247 of query aligns to 2:258/260 of 5b4tA
- active site: G15 (= G18), N114 (= N102), S142 (= S130), Y155 (= Y144), K159 (= K148), I200 (≠ Q189)
- binding (3R)-3-hydroxybutanoic acid: Q94 (≠ V82), S142 (= S130), H144 (≠ A132), K152 (≠ R141), Y155 (= Y144), W187 (≠ T176), Q196 (≠ R185)
- binding nicotinamide-adenine-dinucleotide: G11 (≠ A14), T13 (≠ G16), G15 (= G18), I16 (= I19), F36 (≠ L44), D63 (= D55), L64 (≠ V56), N90 (≠ C78), G92 (= G80), L113 (= L101), I140 (≠ M128), Y155 (= Y144), K159 (= K148), P185 (= P174), G186 (= G175), W187 (≠ T176), V188 (= V177), T190 (≠ S179), L192 (≠ S181), V193 (≠ L182)
3w8dA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and an inhibitor methylmalonate
36% identity, 98% coverage: 5:246/247 of query aligns to 2:258/260 of 3w8dA
- active site: G15 (= G18), N114 (= N102), S142 (= S130), Y155 (= Y144), K159 (= K148), I200 (≠ Q189)
- binding methylmalonic acid: Q94 (≠ V82), S142 (= S130), H144 (≠ A132), K152 (≠ R141), Y155 (= Y144), W187 (≠ T176), Q196 (≠ R185), W257 (= W245)
- binding nicotinamide-adenine-dinucleotide: G11 (≠ A14), T13 (≠ G16), S14 (≠ Q17), G15 (= G18), I16 (= I19), F36 (≠ L44), A62 (vs. gap), D63 (= D55), L64 (≠ V56), N90 (≠ C78), A91 (= A79), G92 (= G80), L113 (= L101), S142 (= S130), Y155 (= Y144), K159 (= K148), P185 (= P174), G186 (= G175), W187 (≠ T176), V188 (= V177), T190 (≠ S179), L192 (≠ S181), V193 (≠ L182)
Query Sequence
>H281DRAFT_03529 FitnessBrowser__Burk376:H281DRAFT_03529
MTQRLAGKTALITAAGQGIGLATAEMFAREGARVIATDIRIDGLAGKPVEARKLDVLDGE
AIKALAAEVGPIDVLFNCAGFVHAGSILECSEEDWDFAFDLNAKAMYRMIRAFLPAMLER
GGGSIINMSSAASSVKGVPNRFAYSASKAAVIGLTKSVAADFVTRGVRCNAICPGTVSSP
SLEQRIAAQAAAQGATLEAVQAAFVARQPMGRIGKAEEIAALALYLASDESAFTTGHAHV
IDGGWSN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory