Comparing H281DRAFT_03530 FitnessBrowser__Burk376:H281DRAFT_03530 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
4dlfA Crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group p3221
38% identity, 99% coverage: 5:280/280 of query aligns to 2:286/287 of 4dlfA
O87170 2-pyrone-4,6-dicarboxylate hydrolase; PDC hydrolase; 2-pyrone-4,6-dicarboxylate lactonase; EC 3.1.1.57 from Sphingobium sp. (strain NBRC 103272 / SYK-6) (see paper)
26% identity, 83% coverage: 7:239/280 of query aligns to 26:248/293 of O87170
Sites not aligning to the query:
>H281DRAFT_03530 FitnessBrowser__Burk376:H281DRAFT_03530
MNVKMHIDAHQHYWDPARGDYEWLTPELEILYRPFGPADLKPLRERAGIERTVVVQAAPT
IDETRYLLGIAREEPSIAGVVGWVPLLLPTAPALIGALAQEPKFKGVRPMLQDLPDDAWI
ANPDLAPAVEALIAHDLAFDALIYARHVDHVETFARRFPSLRIVVDHGAKPPIRYGQAGW
QTWADAIARLAKLPGVHCKLSGLATEASPGWTEETLRPYVEHLLATFGPARLMWGSDWPV
LELNGDYLLWHSVANTLLASLDDGEREAVFGGNAAAFYRL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory