Comparing H281DRAFT_03531 FitnessBrowser__Burk376:H281DRAFT_03531 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7svqA Crystal structure of l-galactose dehydrogenase from spinacia oleracea in complex with NAD+ (see paper)
28% identity, 95% coverage: 11:339/346 of query aligns to 3:304/315 of 7svqA
7ezlA Rice l-galactose dehydrogenase (holo form)
27% identity, 95% coverage: 10:339/346 of query aligns to 3:305/318 of 7ezlA
7eziA Rice l-galactose dehydrogenase (apo form)
27% identity, 95% coverage: 10:339/346 of query aligns to 8:310/323 of 7eziA
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
26% identity, 89% coverage: 11:318/346 of query aligns to 1:291/311 of 1pz0A
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
26% identity, 89% coverage: 11:318/346 of query aligns to 2:292/310 of P46336
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
23% identity, 92% coverage: 15:333/346 of query aligns to 6:319/326 of P77256
1ynqB Aldo-keto reductase akr11c1 from bacillus halodurans (holo form) (see paper)
27% identity, 90% coverage: 11:320/346 of query aligns to 3:272/298 of 1ynqB
1ynpB Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
27% identity, 90% coverage: 11:320/346 of query aligns to 3:272/298 of 1ynpB
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
26% identity, 88% coverage: 13:318/346 of query aligns to 4:275/301 of 6ow0B
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
25% identity, 88% coverage: 13:318/346 of query aligns to 4:299/323 of 6ow0A
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
28% identity, 69% coverage: 12:249/346 of query aligns to 3:213/337 of Q3L181
1ynpA Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
25% identity, 90% coverage: 11:320/346 of query aligns to 3:257/283 of 1ynpA
Sites not aligning to the query:
8hw0A The structure of akr6d1
24% identity, 89% coverage: 11:319/346 of query aligns to 2:301/329 of 8hw0A
Q9P7U2 Putative aryl-alcohol dehydrogenase C977.14c; EC 1.1.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
23% identity, 95% coverage: 15:344/346 of query aligns to 12:346/351 of Q9P7U2
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
24% identity, 97% coverage: 12:346/346 of query aligns to 3:280/287 of 3v0sA
Q13303 Voltage-gated potassium channel subunit beta-2; K(+) channel subunit beta-2; Kv-beta-2; hKvbeta2; EC 1.1.1.- from Homo sapiens (Human) (see 2 papers)
22% identity, 91% coverage: 8:321/346 of query aligns to 35:339/367 of Q13303
Sites not aligning to the query:
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
23% identity, 86% coverage: 15:312/346 of query aligns to 6:287/331 of P80874
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
23% identity, 86% coverage: 15:312/346 of query aligns to 6:287/333 of 1pz1A
7wf3C Composite map of human kv1.3 channel in apo state with beta subunits (see paper)
22% identity, 91% coverage: 8:321/346 of query aligns to 2:306/328 of 7wf3C
3erpA Structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium (see paper)
24% identity, 90% coverage: 5:314/346 of query aligns to 7:286/312 of 3erpA
>H281DRAFT_03531 FitnessBrowser__Burk376:H281DRAFT_03531
MTATNGSKIQQRRRVGRSALQVTGLSLGTAPLGGLYRDLSEEEAHATVAAAWNAGVRYFD
TAPHYGHTKAEHRLGDALRRYPRSEYVLSTKVGRRFVPRTNPYDGSEGWQDPLPFEAIYD
YTHDGILRSFEDSQQRLGIVDIDILLVHDIGRVTHGENNTHYWRQLTEGGGFRALDELRS
GGAVKAVGLGVNEGAVILDAMAEFDIDCALLAGRYTLLEQATLDDLLPACEKRGVSILLG
GAFNSGILARGVEGDLKFNYGEAPREVIERVARLETVCRNLGVPLAAAALQFPYAHPAVA
TVLTGARSADELRENAASFELPIPGALWSALREEGLLDPRAPAPQK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory