Comparing H281DRAFT_03634 FitnessBrowser__Burk376:H281DRAFT_03634 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5bokA Ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. Strain ds2
33% identity, 98% coverage: 3:104/104 of query aligns to 1:102/102 of 5bokA
P0A185 Naphthalene 1,2-dioxygenase system, ferredoxin component from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
34% identity, 97% coverage: 1:101/104 of query aligns to 1:101/104 of P0A185
2qpzA Naphthalene 1,2-dioxygenase rieske ferredoxin (see paper)
33% identity, 96% coverage: 2:101/104 of query aligns to 1:100/103 of 2qpzA
Q8GI16 Ferredoxin CarAc; Carbazole 1,9a-dioxygenase, ferredoxin component; CARDO from Pseudomonas resinovorans (see 2 papers)
33% identity, 79% coverage: 23:104/104 of query aligns to 24:105/107 of Q8GI16
4nbbE Carbazole- and oxygen-bound oxygenase with ile262 replaced by val and ferredoxin complex of carbazole 1,9a-dioxygenase (see paper)
33% identity, 79% coverage: 23:104/104 of query aligns to 23:104/114 of 4nbbE
3gceA Ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 (see paper)
34% identity, 85% coverage: 14:101/104 of query aligns to 12:101/104 of 3gceA
1fqtA Crystal structure of the rieske-type ferredoxin associated with biphenyl dioxygenase (see paper)
31% identity, 88% coverage: 13:104/104 of query aligns to 11:103/109 of 1fqtA
2e4pA Crystal structure of bpha3 (oxidized form) (see paper)
33% identity, 79% coverage: 20:101/104 of query aligns to 17:99/108 of 2e4pA
Sites not aligning to the query:
3dqyA Crystal structure of toluene 2,3-dioxygenase ferredoxin (see paper)
26% identity, 96% coverage: 5:104/104 of query aligns to 2:101/106 of 3dqyA
2i7fA Sphingomonas yanoikuyae b1 ferredoxin (see paper)
35% identity, 63% coverage: 29:94/104 of query aligns to 27:92/102 of 2i7fA
7qwtA Rieske non-heme iron monooxygenase for guaiacol o-demethylation
28% identity, 81% coverage: 1:84/104 of query aligns to 7:90/352 of 7qwtA
Sites not aligning to the query:
4qdfB Crystal structure of apo ksha5 and ksha1 in complex with 1,4-30q-coa from r. Rhodochrous (see paper)
30% identity, 78% coverage: 5:85/104 of query aligns to 8:88/357 of 4qdfB
Sites not aligning to the query:
F1CMX0 3-ketosteroid-9-alpha-monooxygenase, oxygenase component; 3-ketosteroid-9-alpha-hydroxylase, oxygenase component; KSH; Androsta-1,4-diene-3,17-dione 9-alpha-hydroxylase; Rieske-type oxygenase; RO; EC 1.14.15.30 from Rhodococcus rhodochrous (see paper)
30% identity, 78% coverage: 5:85/104 of query aligns to 27:107/394 of F1CMX0
Sites not aligning to the query:
Q17938 Cholesterol 7-desaturase; Cholesterol desaturase daf-36; Rieske oxygenase DAF-36/Neverland; DAF-36/NVD; EC 1.14.19.21 from Caenorhabditis elegans (see paper)
27% identity, 75% coverage: 5:82/104 of query aligns to 81:161/428 of Q17938
Sites not aligning to the query:
4qdcA Crystal structure of 3-ketosteroid-9-alpha-hydroxylase 5 (ksha5) from r. Rhodochrous in complex with fe2/s2 (inorganic) cluster (see paper)
29% identity, 78% coverage: 5:85/104 of query aligns to 18:98/369 of 4qdcA
Sites not aligning to the query:
6vshC Crystal structure of apo dicamba monooxygenase (see paper)
28% identity, 90% coverage: 1:94/104 of query aligns to 4:96/320 of 6vshC
F1CMY8 3-ketosteroid-9-alpha-monooxygenase, oxygenase component; 3-ketosteroid-9-alpha-hydroxylase, oxygenase component; KSH; Androsta-1,4-diene-3,17-dione 9-alpha-hydroxylase; Rieske-type oxygenase; RO; EC 1.14.15.30 from Rhodococcus rhodochrous (see paper)
29% identity, 78% coverage: 5:85/104 of query aligns to 32:112/390 of F1CMY8
Sites not aligning to the query:
4qddA Crystal structure of 3-ketosteroid-9-alpha-hydroxylase 5 (ksha5) from r. Rhodochrous in complex with 1,4-30q-coa (see paper)
29% identity, 78% coverage: 5:85/104 of query aligns to 18:98/366 of 4qddA
Sites not aligning to the query:
2zylA Crystal structure of 3-ketosteroid-9-alpha-hydroxylase (ksha) from m. Tuberculosis (see paper)
36% identity, 62% coverage: 5:68/104 of query aligns to 13:77/359 of 2zylA
Sites not aligning to the query:
4qckA Crystal structure of 3-ketosteroid-9-alpha-hydroxylase (ksha) from m. Tuberculosis in complex with 4-androstene-3,17-dione (see paper)
36% identity, 62% coverage: 5:68/104 of query aligns to 13:77/355 of 4qckA
Sites not aligning to the query:
>H281DRAFT_03634 FitnessBrowser__Burk376:H281DRAFT_03634
MTEQWRCAGHAGDLSEDAPLEFKLDGTEIGIYKVGDALYALENVCPHAYALLTQGFVDGD
TVECPLHEAVFHIPTGKCLKEPGGRDLKMYSVRLAGEEIQIKVE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory