SitesBLAST
Comparing H281DRAFT_03637 FitnessBrowser__Burk376:H281DRAFT_03637 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
35% identity, 96% coverage: 9:254/255 of query aligns to 5:244/244 of 4nbuB
- active site: G18 (= G22), N111 (= N121), S139 (= S149), Q149 (≠ L159), Y152 (= Y162), K156 (= K166)
- binding acetoacetyl-coenzyme a: D93 (≠ S101), K98 (≠ E108), S139 (= S149), N146 (≠ A156), V147 (≠ P157), Q149 (≠ L159), Y152 (= Y162), F184 (≠ L194), M189 (≠ A199), K200 (≠ Y210)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G18), N17 (≠ R21), G18 (= G22), I19 (≠ L23), D38 (= D42), F39 (≠ V43), V59 (≠ L67), D60 (= D68), V61 (≠ L69), N87 (= N95), A88 (= A96), G89 (≠ A97), I90 (= I98), T137 (≠ I147), S139 (= S149), Y152 (= Y162), K156 (= K166), P182 (= P192), F184 (≠ L194), T185 (= T195), T187 (≠ V197), M189 (≠ A199)
1nfqA Rv2002 gene product from mycobacterium tuberculosis (see paper)
39% identity, 97% coverage: 6:253/255 of query aligns to 1:238/244 of 1nfqA
- active site: G17 (= G22), S139 (= S149), Y152 (= Y162), K156 (= K166)
- binding Androsterone: L91 (≠ T99), E141 (≠ T151), C149 (≠ L159), Y152 (= Y162), V193 (= V203), I197 (≠ R207), F198 (≠ H208)
- binding 1,4-dihydronicotinamide adenine dinucleotide: R16 (= R21), G17 (= G22), M18 (≠ L23), D37 (= D42), L39 (= L44), L59 (= L67), D60 (= D68), V61 (≠ L69), N87 (= N95), A88 (= A96), I137 (= I147), S139 (= S149), Y152 (= Y162), K156 (= K166), P182 (= P192), V185 (≠ T195), T187 (≠ V197), P188 (≠ E198), M189 (≠ A199), T190 (= T200)
1nffA Crystal structure of rv2002 gene product from mycobacterium tuberculosis (see paper)
39% identity, 97% coverage: 6:253/255 of query aligns to 1:238/244 of 1nffA
- active site: G17 (= G22), S139 (= S149), Y152 (= Y162), K156 (= K166)
- binding nicotinamide-adenine-dinucleotide: G13 (= G18), R16 (= R21), G17 (= G22), M18 (≠ L23), D37 (= D42), I38 (≠ V43), L39 (= L44), L59 (= L67), D60 (= D68), V61 (≠ L69), N87 (= N95), A88 (= A96), G89 (≠ A97), I90 (= I98), I137 (= I147), S139 (= S149), Y152 (= Y162), K156 (= K166), P182 (= P192), V185 (≠ T195), T187 (≠ V197), P188 (≠ E198), M189 (≠ A199), T190 (= T200)
P9WGT1 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase; NADH-dependent 3alpha, 20beta-hydroxysteroid dehydrogenase; EC 1.1.1.53 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
39% identity, 97% coverage: 6:253/255 of query aligns to 2:239/260 of P9WGT1
- I6 (≠ N10) mutation to T: Maximal improvement in solubility; when associated with M-47 and K-69.
- RGM 17:19 (≠ RGL 21:23) binding
- D38 (= D42) binding
- V47 (≠ L51) mutation to M: Maximal improvement in solubility; when associated with T-6 and K-69.
- DV 61:62 (≠ DL 68:69) binding
- T69 (≠ K76) mutation to K: Maximal improvement in solubility; when associated with T-6 and M-47.
- N88 (= N95) binding
- S140 (= S149) mutation to A: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- Y153 (= Y162) binding ; mutation to F: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- K157 (= K166) binding
- 183:191 (vs. 192:200, 44% identical) binding
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
34% identity, 96% coverage: 9:252/255 of query aligns to 3:248/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), Q15 (≠ R21), G16 (= G22), I17 (≠ L23), D36 (= D42), V63 (≠ L69), N89 (= N95), A91 (= A97), S94 (≠ N100), I142 (= I147), S143 (≠ A148), S144 (= S149), Y157 (= Y162), K161 (= K166), P187 (= P192), H188 (≠ G193), I190 (vs. gap), I194 (≠ V197)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
36% identity, 97% coverage: 9:255/255 of query aligns to 4:252/252 of 1vl8B
- active site: G17 (= G22), S143 (= S149), I154 (≠ L159), Y157 (= Y162), K161 (= K166)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G18), R16 (= R21), G17 (= G22), L18 (= L23), S37 (≠ D42), R38 (≠ V43), C63 (≠ L67), D64 (= D68), V65 (≠ L69), A91 (≠ N95), A92 (= A96), G93 (≠ A97), I94 (= I98), V114 (= V120), I141 (= I147), S143 (= S149), Y157 (= Y162), K161 (= K166), P187 (= P192), G188 (= G193), Y190 (vs. gap), T192 (= T195), M194 (≠ V197), T195 (≠ E198)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
35% identity, 97% coverage: 8:254/255 of query aligns to 2:247/247 of 4jroC
- active site: G16 (= G22), S142 (= S149), Q152 (≠ L159), Y155 (= Y162), K159 (= K166)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G18), S14 (≠ A20), R15 (= R21), G16 (= G22), I17 (≠ L23), N35 (≠ G41), Y36 (vs. gap), N37 (≠ D42), G38 (≠ V43), S39 (≠ L44), N63 (≠ D68), V64 (≠ L69), N90 (= N95), A91 (= A96), I93 (= I98), I113 (≠ V120), S142 (= S149), Y155 (= Y162), K159 (= K166), P185 (= P192), I188 (≠ T195), T190 (≠ V197)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
38% identity, 95% coverage: 11:252/255 of query aligns to 5:236/240 of 2d1yA
- active site: G16 (= G22), S135 (= S149), N145 (≠ L159), Y148 (= Y162), K152 (= K166)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), R15 (= R21), I17 (≠ L23), D36 (= D42), L37 (= L44), R38 (≠ H45), V55 (≠ L67), D56 (= D68), L57 (= L69), N83 (= N95), A84 (= A96), A85 (= A97), I86 (= I98), V133 (≠ I147), S135 (= S149), Y148 (= Y162), K152 (= K166), P178 (= P192), G179 (= G193), I181 (≠ T195), T183 (≠ V197), A185 (= A199), V186 (≠ T200)
3rwbA Crystal structure of complex of 4pal (4-pyridoxolactone) and pldh (tetrameric pyridoxal 4-dehydrogenase) from mesorhizobium loti
37% identity, 96% coverage: 9:253/255 of query aligns to 4:245/247 of 3rwbA
- active site: G17 (= G22), S140 (= S149), Y153 (= Y162), K157 (= K166)
- binding 7-hydroxy-6-methylfuro[3,4-c]pyridin-1(3H)-one: S140 (= S149), N141 (≠ D150), T142 (= T151), M150 (≠ L159), Y153 (= Y162), L185 (= L194), H196 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G13 (= G18), Q16 (≠ R21), G17 (= G22), I18 (≠ L23), D37 (= D42), I38 (≠ V43), D60 (= D68), I61 (≠ L69), N87 (= N95), A88 (= A96), S89 (≠ A97), I138 (= I147), S140 (= S149), Y153 (= Y162), K157 (= K166), P183 (= P192), L185 (= L194), I186 (≠ T195), S188 (≠ V197), G190 (≠ A199), V191 (≠ T200)
3ndrA Crystal structure of tetrameric pyridoxal 4-dehydrogenase from mesorhizobium loti
37% identity, 96% coverage: 9:253/255 of query aligns to 4:245/247 of 3ndrA
- active site: G17 (= G22), S140 (= S149), Y153 (= Y162), K157 (= K166)
- binding nicotinamide-adenine-dinucleotide: G13 (= G18), Q16 (≠ R21), G17 (= G22), I18 (≠ L23), D37 (= D42), I38 (≠ V43), D60 (= D68), I61 (≠ L69), N87 (= N95), A88 (= A96), S89 (≠ A97), V110 (= V120), I138 (= I147), S140 (= S149), Y153 (= Y162), K157 (= K166), P183 (= P192), L185 (= L194), I186 (≠ T195), S188 (≠ V197), G190 (≠ A199), V191 (≠ T200)
5ha5D Crystal structure of an NAD-bound oxidoreductase from brucella ovis
34% identity, 96% coverage: 9:253/255 of query aligns to 4:242/244 of 5ha5D
- active site: G17 (= G22), S142 (= S149), Y155 (= Y162), K159 (= K166)
- binding nicotinamide-adenine-dinucleotide: G13 (= G18), R16 (= R21), G17 (= G22), L18 (= L23), D37 (= D42), I38 (≠ V43), L62 (= L67), D63 (= D68), V64 (≠ L69), N90 (= N95), A91 (= A96), S142 (= S149), Y155 (= Y162), K159 (= K166), G186 (= G193), M188 (≠ T195), S190 (≠ V197)
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
34% identity, 95% coverage: 9:251/255 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G18), M16 (≠ L23), D35 (= D42), I36 (≠ V43), I62 (≠ L69), N88 (= N95), G90 (≠ A97), I138 (= I147), S140 (= S149), Y152 (= Y162), K156 (= K166), I185 (≠ T195)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
34% identity, 95% coverage: 9:251/255 of query aligns to 3:242/248 of Q9KJF1
- S15 (≠ R21) binding
- D36 (= D42) binding
- D62 (= D68) binding
- I63 (≠ L69) binding
- N89 (= N95) binding
- Y153 (= Y162) binding
- K157 (= K166) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
36% identity, 97% coverage: 9:255/255 of query aligns to 5:258/258 of 3ak4A
- active site: G18 (= G22), S141 (= S149), L151 (= L159), Y154 (= Y162), K158 (= K166), E199 (= E196)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ R21), G18 (= G22), I19 (≠ L23), D38 (= D42), L39 (≠ V43), V60 (≠ L67), D61 (= D68), V62 (≠ L69), N88 (= N95), A89 (= A96), G90 (≠ A97), T139 (≠ I147), S141 (= S149), Y154 (= Y162), K158 (= K166), G185 (= G193), V187 (≠ T195), T189 (vs. gap), M191 (vs. gap)
2hsdA The refined three-dimensional structure of 3alpha,20beta- hydroxysteroid dehydrogenase and possible roles of the residues conserved in short-chain dehydrogenases (see paper)
38% identity, 96% coverage: 9:252/255 of query aligns to 3:241/253 of 2hsdA
- active site: G16 (= G22), S138 (= S149), Y151 (= Y162), K155 (= K166)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), R15 (= R21), G16 (= G22), L17 (= L23), D36 (= D42), V37 (= V43), L58 (= L67), V60 (≠ L69), N86 (= N95), A87 (= A96), S138 (= S149), Y151 (= Y162), K155 (= K166), P181 (= P192), G182 (= G193), T184 (= T195)
1hdcA Mechanism of inhibition of 3alpha,20beta-hydroxysteroid dehydrogenase by a licorice-derived steroidal inhibitor (see paper)
38% identity, 96% coverage: 9:252/255 of query aligns to 3:241/253 of 1hdcA
- active site: G16 (= G22), S138 (= S149), Y151 (= Y162), K155 (= K166)
- binding carbenoxolone: S90 (= S101), T91 (≠ G102), G92 (= G103), L147 (≠ K158), Y151 (= Y162), M183 (≠ L194), M188 (≠ A199), T189 (= T200), T192 (≠ V203)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
35% identity, 97% coverage: 9:255/255 of query aligns to 3:244/244 of 7krmC
- active site: G18 (= G22), S140 (= S149), Y155 (= Y162)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), S15 (vs. gap), G18 (= G22), I19 (≠ L23), D38 (= D42), L39 (≠ V43), A60 (≠ L67), N61 (≠ D68), V62 (≠ L69), N88 (= N95), V111 (= V120), S140 (= S149), Y155 (= Y162), K159 (= K166), I188 (≠ T195), T190 (≠ V197)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
34% identity, 96% coverage: 9:254/255 of query aligns to 6:247/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G18), R18 (= R21), G19 (= G22), I20 (≠ L23), D39 (= D42), R40 (≠ L44), C63 (≠ L67), I65 (≠ L69), N91 (= N95), G93 (≠ A97), I94 (= I98), V114 (= V120), Y155 (= Y162), K159 (= K166), I188 (≠ T195), T190 (≠ V197), T193 (= T200)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
31% identity, 96% coverage: 8:252/255 of query aligns to 4:252/255 of 5itvA
- active site: G18 (= G22), S141 (= S149), Y154 (= Y162), K158 (= K166)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G18), S17 (≠ R21), G18 (= G22), I19 (≠ L23), D38 (= D42), I39 (≠ V43), T61 (≠ L67), I63 (≠ L69), N89 (= N95), G91 (≠ A97), T139 (≠ I147), S141 (= S149), Y154 (= Y162), K158 (= K166), P184 (= P192), G185 (= G193), I186 (≠ L194), I187 (≠ T195)
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
35% identity, 95% coverage: 12:254/255 of query aligns to 5:243/244 of 6t62A
- active site: G16 (= G22), S138 (= S149), Y151 (= Y162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G18), S14 (≠ A20), R15 (= R21), A36 (≠ V43), T37 (≠ L44), L58 (= L67), D59 (= D68), V60 (≠ L69), N86 (= N95), A87 (= A96), G88 (≠ A97), I89 (= I98), I136 (= I147), S137 (≠ A148), S138 (= S149), Y151 (= Y162), K155 (= K166), P181 (= P192), G182 (= G193), I184 (≠ T195), M188 (≠ A199)
Query Sequence
>H281DRAFT_03637 FitnessBrowser__Burk376:H281DRAFT_03637
MHKDASATLNGRRVLVTGGARGLGAAFVRALVQAGAQVVFGDVLHEEGRALAASLAGQGH
AAIYLPLDLADPESIKQFAEQGASRLGGIDALINNAAITNSGGKFADELSVDTWDAVMNV
NVRGTWLMSTAVLPYLRDSGRGSIVNIASDTAMWGAPKLLAYVASKGAVISMTRSLAREF
GAHQVTVNAIAPGLTEVEATAYVPAERHEYYLQGRALTRAQVPDDVTGPVLFLLSDAARF
VTGQLLPVNGGFVMN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory