Comparing H281DRAFT_03659 FitnessBrowser__Burk376:H281DRAFT_03659 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
47% identity, 88% coverage: 36:284/284 of query aligns to 5:260/260 of P02911
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
49% identity, 81% coverage: 54:284/284 of query aligns to 2:235/235 of 5owfA
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
49% identity, 81% coverage: 54:284/284 of query aligns to 5:238/238 of 1lstA
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
49% identity, 81% coverage: 54:284/284 of query aligns to 5:238/238 of 1lahE
1lagE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
49% identity, 81% coverage: 54:284/284 of query aligns to 5:238/238 of 1lagE
1lafE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
49% identity, 81% coverage: 54:284/284 of query aligns to 5:238/238 of 1lafE
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
45% identity, 81% coverage: 54:283/284 of query aligns to 27:259/260 of P0AEU0
Sites not aligning to the query:
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
45% identity, 81% coverage: 55:283/284 of query aligns to 28:259/260 of P02910
Sites not aligning to the query:
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
45% identity, 81% coverage: 55:283/284 of query aligns to 6:237/238 of 1hslA
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
32% identity, 79% coverage: 54:277/284 of query aligns to 5:225/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
33% identity, 79% coverage: 54:277/284 of query aligns to 5:223/225 of 4zv2A
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
32% identity, 81% coverage: 49:277/284 of query aligns to 2:227/228 of 2y7iA
5itoA Structure of the periplasmic binding protein m117n-noct from a. Tumefaciens in complex with octopine (see paper)
29% identity, 81% coverage: 51:280/284 of query aligns to 1:252/255 of 5itoA
8hqrA Crystal structure of the arginine-/lysine-binding protein sar11_1210 from 'candidatus pelagibacter ubique' htcc1062 bound to arginine
32% identity, 80% coverage: 53:280/284 of query aligns to 8:264/267 of 8hqrA
5otaA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with octopinic acid (see paper)
29% identity, 80% coverage: 53:280/284 of query aligns to 2:251/254 of 5otaA
5ot9A Structure of the periplasmic binding protein (pbp) noct from a.Tumefaciens c58 in complex with histopine. (see paper)
29% identity, 80% coverage: 53:280/284 of query aligns to 2:251/254 of 5ot9A
4powA Structure of the pbp noct in complex with pyronopaline (see paper)
29% identity, 80% coverage: 53:280/284 of query aligns to 2:251/254 of 4powA
5ovzA High resolution structure of the pbp noct in complex with nopaline (see paper)
29% identity, 81% coverage: 51:280/284 of query aligns to 1:252/259 of 5ovzA
5otcA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with noroctopinic acid. (see paper)
29% identity, 80% coverage: 53:280/284 of query aligns to 2:251/256 of 5otcA
5orgA Structure of the periplasmic binding protein (pbp) occj from a. Tumefaciens b6 in complex with octopine. (see paper)
30% identity, 81% coverage: 51:280/284 of query aligns to 2:253/257 of 5orgA
>H281DRAFT_03659 FitnessBrowser__Burk376:H281DRAFT_03659
MIVGTGLLWSAAPAYDDLATIRPLDPSAPMKLPLMIFGAALMFSVGAYAAESNTLRLGID
PSYPPMDSKAPDGSLKGFDVDLGNEICRRIQARCQWVELEFSGMIPALQARKIDAILSSM
AITQKREQQILFTSKLFQFKSRLIARQGSPLAAGLQALSGKQIGVQSGTQFEGYALTHWV
PLGAHVVAYKSQDEVFADLQNGRLDGALLGSVEADFGFLRTPAGKGFAFVGEPLSMGDRG
TGIGLRKDETAIQASINAAIAAMLKDGTYAQIAKKYFDFDPYGN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory