SitesBLAST
Comparing H281DRAFT_03668 FitnessBrowser__Burk376:H281DRAFT_03668 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8hw0A The structure of akr6d1
38% identity, 92% coverage: 1:304/331 of query aligns to 1:300/329 of 8hw0A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), W21 (vs. gap), Q27 (= Q26), D49 (= D48), Y54 (= Y53), R123 (≠ T127), S152 (= S156), Q178 (= Q182), W207 (≠ Y210), S208 (≠ N211), P209 (= P212), L210 (= L213), S212 (≠ G215), K218 (= K221), S227 (≠ G231), R228 (= R232), I285 (= I289), G287 (= G291), S289 (= S293), Q293 (= Q297), D296 (= D300), N297 (≠ T301)
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
34% identity, 96% coverage: 1:319/331 of query aligns to 1:314/323 of 6ow0A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), L21 (≠ M21), D49 (= D48), Y54 (= Y53), S151 (= S156), Y204 (= Y210), F205 (≠ N211), L207 (= L213), Q209 (≠ G215), G210 (= G216), T213 (= T219), K215 (= K221), R227 (≠ T234), V284 (≠ I289), G286 (= G291), Q292 (= Q297), N296 (≠ T301)
4aubB The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
35% identity, 92% coverage: 1:304/331 of query aligns to 11:303/335 of 4aubB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G29 (= G19), W31 (≠ M21), D59 (= D48), Y64 (= Y53), H136 (= H126), Q191 (= Q182), F220 (≠ Y210), T221 (≠ N211), P222 (= P212), L223 (= L213), Q225 (≠ G215), G226 (= G216), K231 (= K221), R241 (= R232), R244 (≠ Q245), L288 (≠ I289), G290 (= G291), S292 (= S293), Q296 (= Q297), E299 (≠ D300), N300 (≠ T301)
Sites not aligning to the query:
1lqaA Tas protein from escherichia coli in complex with NADPH (see paper)
35% identity, 98% coverage: 1:326/331 of query aligns to 1:343/346 of 1lqaA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), M21 (= M21), D48 (= D48), Y53 (= Y53), H132 (= H126), N180 (= N157), Q205 (= Q182), Y233 (= Y210), S234 (≠ N211), L236 (= L213), F238 (≠ G215), G239 (= G216), T242 (= T219), K244 (= K221), A254 (vs. gap), R255 (vs. gap), G308 (= G291), T310 (≠ S293), Q314 (= Q297), N318 (≠ T301)
P0A9T4 Protein tas from Escherichia coli (strain K12) (see paper)
35% identity, 98% coverage: 1:326/331 of query aligns to 1:343/346 of P0A9T4
- 234:244 (vs. 211:221, 55% identical) binding
5t79A X-ray crystal structure of a novel aldo-keto reductases for the biocatalytic conversion of 3-hydroxybutanal to 1,3-butanediol (see paper)
35% identity, 92% coverage: 1:303/331 of query aligns to 13:294/315 of 5t79A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G31 (= G19), W33 (≠ M21), Y66 (= Y53), H138 (= H126), N169 (= N157), Q193 (= Q182), F221 (≠ Y210), S222 (≠ N211), L224 (= L213), G226 (= G215), T230 (= T219), R232 (≠ K221), S263 (≠ T272), L280 (≠ I289), G282 (= G291), S284 (= S293), Q288 (= Q297)
3erpA Structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium (see paper)
35% identity, 92% coverage: 1:303/331 of query aligns to 12:289/312 of 3erpA
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
33% identity, 96% coverage: 1:319/331 of query aligns to 1:290/301 of 6ow0B
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), L21 (≠ M21), Y50 (= Y53), H117 (= H126), S147 (= S156), Y200 (= Y210), F201 (≠ N211), L203 (= L213), Q205 (≠ G215), T209 (= T219), Q268 (= Q297), N272 (≠ T301)
3n6qD Crystal structure of yghz from e. Coli (see paper)
34% identity, 92% coverage: 1:304/331 of query aligns to 12:290/315 of 3n6qD
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
34% identity, 93% coverage: 1:309/331 of query aligns to 1:297/310 of P46336
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
34% identity, 92% coverage: 5:309/331 of query aligns to 4:296/311 of 1pz0A
- active site: D52 (= D48), Y57 (= Y53), N91 (≠ S93), H124 (= H126)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: H124 (= H126), Q174 (= Q182), Y202 (= Y210), F203 (≠ N211), P204 (= P212), L205 (= L213), S207 (≠ G215), G208 (= G216), A211 (≠ T219), K213 (= K221)
6hg6A Clostridium beijerinckii aldo-keto reductase cbei_3974 with NADPH (see paper)
34% identity, 90% coverage: 1:298/331 of query aligns to 12:287/313 of 6hg6A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G30 (= G19), W32 (vs. gap), D60 (= D48), Y65 (= Y53), H137 (= H126), Q192 (= Q182), F221 (≠ Y210), S222 (≠ N211), P223 (= P212), L224 (= L213), L278 (≠ I289), I279 (= I290), G280 (= G291), Q286 (= Q297)
Sites not aligning to the query:
4aubE The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
34% identity, 92% coverage: 1:304/331 of query aligns to 12:278/297 of 4aubE
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G30 (= G19), W32 (≠ M21), D60 (= D48), Y65 (= Y53), Q192 (= Q182), F221 (≠ Y210), T222 (≠ N211), P223 (= P212), L224 (= L213), Q226 (≠ G215), T230 (= T219), K232 (= K221), L263 (≠ I289), G265 (= G291), S267 (= S293), Q271 (= Q297), E274 (≠ D300), N275 (≠ T301)
Sites not aligning to the query:
3eauA Voltage-dependent k+ channel beta subunit in complex with cortisone (see paper)
31% identity, 95% coverage: 3:318/331 of query aligns to 5:318/327 of 3eauA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G21 (= G19), W23 (vs. gap), Q29 (= Q26), D51 (= D48), Y56 (= Y53), K84 (= K85), S154 (= S156), Q180 (= Q182), W209 (≠ Y210), S210 (≠ N211), P211 (= P212), L212 (= L213), A213 (= A214), C214 (≠ G215), G215 (= G216), K220 (= K221), R230 (= R232), L287 (≠ I289), L288 (≠ I290), G289 (= G291), S291 (= S293), Q295 (= Q297), E298 (≠ D300), N299 (≠ T301)
- binding 17,21-dihydroxypregna-1,4-diene-3,11,20-trione: W23 (vs. gap), V55 (= V52), Y56 (= Y53), W87 (≠ G88), N124 (≠ H126), R155 (≠ N157), I174 (≠ A176), I177 (≠ V179), I202 (≠ E203)
1exbA Structure of the cytoplasmic beta subunit-t1 assembly of voltage- dependent k channels (see paper)
31% identity, 95% coverage: 3:318/331 of query aligns to 4:317/326 of 1exbA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G19), W22 (vs. gap), Q28 (= Q26), D50 (= D48), Y55 (= Y53), S153 (= S156), R154 (≠ N157), Q179 (= Q182), W208 (≠ Y210), S209 (≠ N211), P210 (= P212), L211 (= L213), C213 (≠ G215), G214 (= G216), S217 (≠ T219), K219 (= K221), S228 (≠ G231), R229 (= R232), L286 (≠ I289), G288 (= G291), S290 (= S293), Q294 (= Q297), E297 (≠ D300), N298 (≠ T301)
P62483 Voltage-gated potassium channel subunit beta-2; K(+) channel subunit beta-2; Kv-beta-2; EC 1.1.1.- from Rattus norvegicus (Rat) (see 11 papers)
31% identity, 95% coverage: 3:318/331 of query aligns to 39:352/367 of P62483
- T56 (= T20) binding
- W57 (vs. gap) binding
- Q63 (= Q26) binding
- D85 (= D48) binding
- Y90 (= Y53) mutation to F: Abolishes enzyme activity, but has no effect on NADPH binding.
- S112 (≠ R79) modified: Phosphoserine
- N158 (≠ H126) binding
- S188 (= S156) binding
- R189 (≠ N157) binding
- Q214 (= Q182) binding
- W243 (≠ Y210) binding
- S244 (≠ N211) binding
- P245 (= P212) binding
- L246 (= L213) binding
- A247 (= A214) binding
- C248 (≠ G215) binding
- K254 (= K221) binding
- Y262 (≠ S230) binding
- R264 (= R232) binding
- G323 (= G291) binding
- S325 (= S293) binding
- Q329 (= Q297) binding
- E332 (≠ D300) binding
- N333 (≠ T301) binding
Sites not aligning to the query:
- 9 modified: Phosphoserine; S→A: Impairs interaction with MAPRE1 and association with microtubules.
- 20 modified: Phosphoserine; S→A: No effect on interaction with MAPRE1 and association with microtubules.
- 31 S→A: Impairs interaction with MAPRE1 and association with microtubules.
P62482 Voltage-gated potassium channel subunit beta-2; K(+) channel subunit beta-2; Kv-beta-2; Neuroimmune protein F5; EC 1.1.1.- from Mus musculus (Mouse) (see 2 papers)
31% identity, 95% coverage: 3:318/331 of query aligns to 39:352/367 of P62482
- Y90 (= Y53) mutation to F: No detectable phenotype.
- S112 (≠ R79) modified: Phosphoserine
Sites not aligning to the query:
- 20 modified: Phosphoserine
Q9P7U2 Putative aryl-alcohol dehydrogenase C977.14c; EC 1.1.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
31% identity, 96% coverage: 3:319/331 of query aligns to 9:340/351 of Q9P7U2
- S113 (vs. gap) modified: Phosphoserine
P63144 Voltage-gated potassium channel subunit beta-1; K(+) channel subunit beta-1; Kv-beta-1; EC 1.1.1.- from Rattus norvegicus (Rat) (see paper)
32% identity, 93% coverage: 1:308/331 of query aligns to 71:374/401 of P63144
- K152 (= K85) mutation to M: Loss of enzyme activity.
7wf3C Composite map of human kv1.3 channel in apo state with beta subunits (see paper)
31% identity, 95% coverage: 3:318/331 of query aligns to 6:319/328 of 7wf3C
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G22 (= G19), R156 (≠ N157), W210 (≠ Y210), S211 (≠ N211), P212 (= P212), L213 (= L213), C215 (≠ G215), K221 (= K221), R231 (= R232), Q296 (= Q297), E299 (≠ D300), N300 (≠ T301)
Query Sequence
>H281DRAFT_03668 FitnessBrowser__Burk376:H281DRAFT_03668
MQYRKFGRTGLTVSRLCLGTMTFGLQTEEDASRRILDTAADAGVNFIDTADVYPLGSDHS
DAGRTEEIVGRWLKGKRDRFILATKAVGKMGPSAWDQGASRKHLLDAIDASLKRLGTDYV
DLYQLHTDDASTPLDETLEALDVIVRSGKARYIGVSNFLAYRLARALGRADVLRVARFVS
VQPRYNLLFRQIERELLPLAAEEQLAVMPYNPLAGGLLTGKHKLDAAPPSGRFTETVGKA
GAMYQERYWHQREFETIERLKAIVEPTGESLTRVSLAWVLANPLVTSAIIGASRAEQLND
TLAASELVLHADIKQQLDEASVEYRWGDAAR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory