SitesBLAST
Comparing H281DRAFT_03713 FitnessBrowser__Burk376:H281DRAFT_03713 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3toxA Crystal structure of a short chain dehydrogenase in complex with NAD(p) from sinorhizobium meliloti 1021
61% identity, 99% coverage: 2:253/254 of query aligns to 1:254/254 of 3toxA
- active site: G16 (= G17), S142 (≠ T143), V153 (≠ T154), Y156 (= Y157), K160 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (= S15), S15 (≠ A16), G16 (= G17), I17 (= I18), A36 (= A37), R37 (= R38), N38 (≠ R39), V63 (= V64), N89 (= N90), A90 (= A91), G91 (= G92), T140 (= T141), S142 (≠ T143), Y156 (= Y157), K160 (= K161), P186 (= P187), G188 (≠ A189), T189 (≠ V190), T191 (= T192)
7djsD Crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with NAD
47% identity, 97% coverage: 4:250/254 of query aligns to 3:249/251 of 7djsD
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G16 (= G17), I17 (= I18), D36 (≠ A37), L37 (≠ R38), C61 (≠ G62), D62 (= D63), V63 (= V64), N89 (= N90), A90 (= A91), T140 (= T141), S142 (≠ T143), Y155 (= Y157), K159 (= K161), A186 (≠ G188), V187 (≠ A189)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
39% identity, 96% coverage: 4:248/254 of query aligns to 3:244/248 of 6ixmC
- active site: G16 (= G17), S142 (≠ T143), Y155 (= Y157), K159 (= K161)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), S15 (≠ A16), G16 (= G17), I17 (= I18), D36 (≠ A37), I37 (≠ R38), A61 (≠ G62), D62 (= D63), T63 (≠ V64), N89 (= N90), A90 (= A91), M140 (≠ T141), S142 (≠ T143), Y155 (= Y157), K159 (= K161), P185 (= P187), A186 (≠ G188), Y187 (≠ A189), I188 (≠ V190), L192 (≠ M194)
4fn4A Short-chain NAD(h)-dependent dehydrogenase/reductase from sulfolobus acidocaldarius (see paper)
40% identity, 98% coverage: 2:251/254 of query aligns to 3:253/254 of 4fn4A
- active site: G18 (= G17), S144 (≠ T143), Y157 (= Y157), K161 (= K161), S202 (= S204)
- binding nicotinamide-adenine-dinucleotide: G14 (= G13), S17 (≠ A16), G18 (= G17), I19 (= I18), E38 (≠ A37), L39 (≠ R38), R43 (≠ E42), A63 (≠ G62), D64 (= D63), V65 (= V64), N91 (= N90), G93 (= G92), I94 (≠ T93), T142 (= T141), S144 (≠ T143), Y157 (= Y157), K161 (= K161), P187 (= P187), V190 (= V190), T192 (= T192), N193 (≠ E193), I194 (≠ M194)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
40% identity, 96% coverage: 4:248/254 of query aligns to 3:244/248 of 4urfB
- active site: G16 (= G17), S142 (≠ T143), I152 (≠ T154), Y155 (= Y157), K159 (= K161)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (= L214), R211 (≠ K215), R212 (= R216)
- binding bicarbonate ion: I92 (≠ T93), G94 (= G95), R109 (≠ A110), R179 (= R181), S228 (= S232)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G14 (≠ S15), N15 (≠ A16), G16 (= G17), I17 (= I18), D36 (≠ A37), I37 (≠ R38), D62 (= D63), T63 (≠ V64), N89 (= N90), A90 (= A91), G91 (= G92), I140 (≠ T141), Y155 (= Y157), K159 (= K161), P185 (= P187), A186 (≠ G188), I188 (≠ V190), T190 (= T192)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
40% identity, 96% coverage: 4:248/254 of query aligns to 3:244/248 of 4urfA
- active site: G16 (= G17), S142 (≠ T143), I152 (≠ T154), Y155 (= Y157), K159 (= K161)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (≠ T93), S93 (≠ L94), G94 (= G95), E95 (= E96), T97 (≠ G98), E101 (≠ G102), T103 (≠ S104), Q106 (≠ G107), R109 (≠ A110), S175 (≠ A177), G177 (= G179)
- binding magnesium ion: S237 (≠ T241), Y238 (≠ A242)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G14 (≠ S15), N15 (≠ A16), G16 (= G17), I17 (= I18), D36 (≠ A37), I37 (≠ R38), W41 (≠ E42), D62 (= D63), T63 (≠ V64), N89 (= N90), A90 (= A91), G91 (= G92), I140 (≠ T141), Y155 (= Y157), K159 (= K161), P185 (= P187), I188 (≠ V190), T190 (= T192)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
40% identity, 96% coverage: 4:248/254 of query aligns to 3:244/248 of 4ureB
- active site: G16 (= G17), S142 (≠ T143), I152 (≠ T154), Y155 (= Y157), K159 (= K161)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ A16), G16 (= G17), I17 (= I18), N89 (= N90), G91 (= G92), Y155 (= Y157), P185 (= P187), A186 (≠ G188)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
37% identity, 98% coverage: 2:250/254 of query aligns to 6:251/258 of 4wecA
- active site: G21 (= G17), S143 (≠ T143), Q154 (≠ T154), Y157 (= Y157), K161 (= K161)
- binding nicotinamide-adenine-dinucleotide: G17 (= G13), A19 (≠ S15), S20 (≠ A16), G21 (= G17), I22 (= I18), D41 (≠ E42), I42 (≠ L43), V61 (≠ G62), D62 (= D63), V63 (= V64), N89 (= N90), T141 (= T141), Y157 (= Y157), K161 (= K161), P187 (= P187), P189 (≠ A189), V190 (= V190)
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
37% identity, 98% coverage: 2:250/254 of query aligns to 3:251/261 of 1g6kA
- active site: G18 (= G17), S145 (≠ F144), Y158 (= Y157), K162 (= K161)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ A16), G18 (= G17), L19 (≠ I18), R39 (= R38), D65 (= D63), V66 (= V64), N92 (= N90), A93 (= A91), G94 (= G92), M143 (≠ S142), S145 (≠ F144), Y158 (= Y157), P188 (= P187), G189 (= G188), I191 (≠ V190), T193 (= T192)
5ojiA Crystal structure of the dehydrogenase/reductase sdr family member 4 (dhrs4) from caenorhabditis elegans (see paper)
36% identity, 98% coverage: 2:250/254 of query aligns to 6:257/260 of 5ojiA
- active site: G21 (= G17), S148 (≠ T143), Y161 (= Y157), K165 (= K161)
- binding isatin: S148 (≠ T143), S150 (≠ V145), Y161 (= Y157), V193 (≠ A189), S199 (≠ Y195), L202 (≠ M198)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A17 (≠ G13), T19 (≠ S15), I22 (= I18), S41 (≠ A37), R42 (= R38), N43 (≠ R39), N46 (≠ E42), I69 (≠ V64), N95 (= N90), H96 (≠ A91), G97 (= G92), N146 (≠ T141), S148 (≠ T143), Y161 (= Y157), K165 (= K161), G192 (= G188), I194 (≠ V190), T196 (= T192), M198 (= M194)
5ojgA Crystal structure of the dehydrogenase/reductase sdr family member 4 (dhrs4) from caenorhabditis elegans (see paper)
36% identity, 98% coverage: 2:250/254 of query aligns to 6:257/260 of 5ojgA
- active site: G21 (= G17), S148 (≠ T143), Y161 (= Y157), K165 (= K161)
- binding butane-2,3-dione: S148 (≠ T143), Y161 (= Y157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A17 (≠ G13), T19 (≠ S15), G21 (= G17), I22 (= I18), S41 (≠ A37), R42 (= R38), N43 (≠ R39), N46 (≠ E42), I69 (≠ V64), N95 (= N90), H96 (≠ A91), G97 (= G92), N146 (≠ T141), S148 (≠ T143), Y161 (= Y157), K165 (= K161), P191 (= P187), I194 (≠ V190), T196 (= T192), M198 (= M194)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
36% identity, 98% coverage: 2:250/254 of query aligns to 3:251/261 of P40288
- 11:35 (vs. 10:34, 52% identical) binding
- E96 (≠ L94) mutation E->A,G,K: Heat stable.
- D108 (≠ G107) mutation to N: Heat stable.
- V112 (≠ A111) mutation to A: Heat stable.
- E133 (≠ K132) mutation to K: Heat stable.
- V183 (= V182) mutation to I: Heat stable.
- P194 (≠ E193) mutation to Q: Heat stable.
- E210 (≠ T209) mutation to K: Heat stable.
- Y217 (≠ R216) mutation to H: Heat stable.
Sites not aligning to the query:
- 252 Q→L: Heat stable.
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
G9FRD7 7alpha-hydroxysteroid dehydrogenase; 7alpha-HSDH; NADP-dependent 7alpha-hydroxysteroid dehydrogenase; EC 1.1.1.- from Clostridium sardiniense (Clostridium absonum) (see 2 papers)
40% identity, 98% coverage: 1:248/254 of query aligns to 1:248/262 of G9FRD7
- SSTRGI 13:18 (≠ GASAGI 13:18) binding
- R38 (= R38) binding ; mutation to D: Loss of catalytic activity.
- NA 63:64 (≠ DV 63:64) binding
- N90 (= N90) binding
- T145 (= T143) binding
- Y158 (= Y157) binding ; binding
- K162 (= K161) binding
- IGTRA 191:195 (≠ VDTEM 190:194) binding
Sites not aligning to the query:
- 261:262 mutation Missing: 5-fold reduction in catalytic efficiency.
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
39% identity, 97% coverage: 4:250/254 of query aligns to 11:257/267 of 3ay6B
- active site: G24 (= G17), S151 (≠ T143), Y164 (= Y157), K168 (= K161)
- binding beta-D-glucopyranose: E102 (≠ L94), S151 (≠ T143), H153 (≠ G146), W158 (≠ F151), Y164 (= Y157), N202 (≠ Y195), K205 (≠ M198)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G13), T23 (≠ A16), G24 (= G17), L25 (≠ I18), Y45 (≠ R38), D71 (= D63), V72 (= V64), N98 (= N90), A99 (= A91), G100 (= G92), V101 (≠ T93), M149 (≠ T141), S151 (≠ T143), Y164 (= Y157), K168 (= K161), P194 (= P187), G195 (= G188), M197 (≠ V190), T199 (= T192), P200 (≠ E193), I201 (≠ M194), N202 (≠ Y195)
5jc8D Crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans
39% identity, 98% coverage: 3:250/254 of query aligns to 3:258/262 of 5jc8D
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
36% identity, 98% coverage: 1:248/254 of query aligns to 2:251/255 of 5itvA
- active site: G18 (= G17), S141 (≠ T143), Y154 (= Y157), K158 (= K161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), S17 (≠ A16), G18 (= G17), I19 (= I18), D38 (≠ A37), I39 (≠ R38), T61 (≠ G62), I63 (≠ V64), N89 (= N90), G91 (= G92), T139 (= T141), S141 (≠ T143), Y154 (= Y157), K158 (= K161), P184 (= P187), G185 (= G188), I186 (≠ A189), I187 (≠ V190)
5epoA The three-dimensional structure of clostridium absonum 7alpha- hydroxysteroid dehydrogenase (see paper)
40% identity, 97% coverage: 2:248/254 of query aligns to 1:247/261 of 5epoA
- active site: G16 (= G17), T144 (= T143), I152 (≠ P152), Y157 (= Y157), K161 (= K161), R193 (≠ E193)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S12 (≠ G13), T14 (≠ S15), R15 (≠ A16), G16 (= G17), I17 (= I18), R37 (= R38), F61 (≠ G62), N62 (≠ D63), N89 (= N90), Y90 (≠ A91), G91 (= G92), Y157 (= Y157), K161 (= K161), P187 (= P187), G188 (= G188), I190 (≠ V190), T192 (= T192), R193 (≠ E193), A194 (≠ M194), A195 (≠ Y195)
- binding taurochenodeoxycholic acid: T93 (≠ L94), T144 (= T143), G146 (= G146), R154 (≠ T154), Y157 (= Y157), G188 (= G188), N198 (= N199), M199 (≠ D200), F203 (≠ S204)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
37% identity, 98% coverage: 1:248/254 of query aligns to 1:257/261 of 6zzsD
- active site: G18 (= G17), S143 (≠ T143), Y156 (= Y157)
- binding nicotinamide-adenine-dinucleotide: G14 (= G13), S17 (≠ A16), I19 (= I18), D38 (≠ A37), M39 (≠ R38), D64 (= D63), V65 (= V64), N91 (= N90), A92 (= A91), G93 (= G92), M141 (≠ T141), A142 (≠ S142), S143 (≠ T143), Y156 (= Y157), K160 (= K161), P186 (= P187), G187 (= G188), V189 (= V190), T191 (= T192), L193 (≠ M194)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ G95), S143 (≠ T143), N145 (≠ V145), K153 (≠ T154), Y156 (= Y157), Q197 (≠ M198)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
38% identity, 96% coverage: 4:248/254 of query aligns to 4:256/260 of 6zzqA
- active site: G17 (= G17), S142 (≠ T143), Y155 (= Y157)
- binding acetoacetic acid: Q94 (≠ G95), S142 (≠ T143), K152 (≠ T154), Y155 (= Y157), Q196 (≠ M198)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), S16 (≠ A16), G17 (= G17), I18 (= I18), D37 (≠ A37), M38 (≠ R38), D63 (= D63), V64 (= V64), N90 (= N90), A91 (= A91), G92 (= G92), M140 (≠ T141), A141 (≠ S142), S142 (≠ T143), Y155 (= Y157), K159 (= K161), Y187 (≠ A189), V188 (= V190), T190 (= T192)
6zyzA Structure of the borneol dehydrogenases of salvia rosmarinus with NAD+ (see paper)
38% identity, 99% coverage: 2:253/254 of query aligns to 1:250/259 of 6zyzA
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), S15 (≠ A16), G16 (= G17), I17 (= I18), D36 (≠ A37), I37 (≠ R38), Q38 (≠ R39), C58 (≠ G62), D59 (= D63), V60 (= V64), N86 (= N90), A87 (= A91), V90 (≠ L94), I110 (≠ T114), T137 (= T141), Y152 (= Y157), K156 (= K161), V185 (= V190)
- binding (2S)-1-[3-{[(2R)-2-hydroxypropyl]oxy}-2,2-bis({[(2R)-2-hydroxypropyl]oxy}methyl)propoxy]propan-2-ol: P93 (= P99), N94 (≠ S100), S95 (≠ T101), D98 (≠ G102)
Query Sequence
>H281DRAFT_03713 FitnessBrowser__Burk376:H281DRAFT_03713
MQRLIGKVAIVTGASAGIGRATAKLFAKEGAKVVIAARRAAELEALAAEIASEGGEAAYL
AGDVQSEDFAKALVELAVGRFGRLDIAYNNAGTLGEMGPSTGISEAGWNAALATNLTSAF
LGAKHQIPEMLKHGGGSIIFTSTFVGYSFAFPGTAAYAASKAGLIGLTQALAAEYGAQGV
RVNAVLPGAVDTEMYRGMNDSDESQAFVTGLHALKRVAKPEELARSVLYLASDDSSFVTG
TASLVDGGASITRT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory