SitesBLAST
Comparing H281DRAFT_03799 FitnessBrowser__Burk376:H281DRAFT_03799 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 86% coverage: 1:228/264 of query aligns to 7:237/378 of P69874
- C26 (≠ R20) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (= F21) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (= F44) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C53) mutation to T: Loss of ATPase activity and transport.
- L60 (= L59) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ V75) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V131) mutation to M: Loss of ATPase activity and transport.
- D172 (= D168) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
41% identity, 73% coverage: 24:216/264 of query aligns to 14:208/393 of P9WQI3
- H193 (= H201) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
8hprC Lpqy-sugabc in state 4 (see paper)
42% identity, 74% coverage: 24:218/264 of query aligns to 13:209/363 of 8hprC
- binding adenosine-5'-triphosphate: S38 (≠ T51), G39 (= G52), G41 (= G54), K42 (= K55), S43 (= S56), Q82 (= Q92), Q133 (= Q143), G136 (= G146), G137 (= G147), Q138 (≠ M148), H192 (= H201)
- binding magnesium ion: S43 (= S56), Q82 (= Q92)
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
42% identity, 74% coverage: 24:218/264 of query aligns to 13:209/362 of 8hprD
- binding adenosine-5'-triphosphate: S38 (≠ T51), C40 (= C53), G41 (= G54), K42 (= K55), S43 (= S56), T44 (= T57), Q82 (= Q92), R129 (≠ H139), Q133 (= Q143), S135 (= S145), G136 (= G146), G137 (= G147), Q159 (≠ E169), H192 (= H201)
- binding magnesium ion: S43 (= S56), Q82 (= Q92)
Sites not aligning to the query:
8hplC Lpqy-sugabc in state 1 (see paper)
41% identity, 71% coverage: 31:218/264 of query aligns to 16:207/384 of 8hplC
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
37% identity, 72% coverage: 28:216/264 of query aligns to 38:236/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
- binding phosphoaminophosphonic acid-adenylate ester: 12
7aheC Opua inhibited inward facing (see paper)
37% identity, 72% coverage: 28:216/264 of query aligns to 38:236/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
37% identity, 78% coverage: 12:217/264 of query aligns to 7:217/375 of 2d62A
7ahdC Opua (e190q) occluded (see paper)
37% identity, 72% coverage: 28:216/264 of query aligns to 38:236/260 of 7ahdC
- binding adenosine-5'-triphosphate: T39 (= T29), S61 (≠ T51), G62 (= G52), G64 (= G54), K65 (= K55), S66 (= S56), T67 (= T57), Q111 (= Q92), K161 (≠ H142), Q162 (= Q143), S164 (= S145), G166 (= G147), M167 (= M148), Q188 (≠ E169), H221 (= H201)
Sites not aligning to the query:
1g291 Malk (see paper)
38% identity, 71% coverage: 31:217/264 of query aligns to 18:214/372 of 1g291
- binding magnesium ion: D69 (≠ A78), E71 (≠ V80), K72 (≠ D81), K79 (vs. gap), D80 (= D84)
- binding pyrophosphate 2-: S38 (≠ T51), G39 (= G52), C40 (= C53), G41 (= G54), K42 (= K55), T43 (≠ S56), T44 (= T57)
Sites not aligning to the query:
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
36% identity, 82% coverage: 14:229/264 of query aligns to 1:221/369 of P19566
- L86 (≠ V96) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P170) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D175) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
35% identity, 82% coverage: 14:229/264 of query aligns to 1:221/371 of P68187
- A85 (= A95) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ S116) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ A124) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ W127) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ R129) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ D134) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G147) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D168) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
35% identity, 83% coverage: 11:229/264 of query aligns to 2:220/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
35% identity, 83% coverage: 11:229/264 of query aligns to 2:220/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ F21), S37 (≠ T51), G38 (= G52), C39 (= C53), G40 (= G54), K41 (= K55), S42 (= S56), T43 (= T57), Q81 (= Q92), R128 (≠ H139), A132 (≠ Q143), S134 (= S145), G136 (= G147), Q137 (≠ M148), E158 (= E169), H191 (= H201)
- binding magnesium ion: S42 (= S56), Q81 (= Q92)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
35% identity, 83% coverage: 11:229/264 of query aligns to 2:220/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ F21), G38 (= G52), C39 (= C53), G40 (= G54), K41 (= K55), S42 (= S56), T43 (= T57), R128 (≠ H139), S134 (= S145), Q137 (≠ M148)
- binding beryllium trifluoride ion: S37 (≠ T51), G38 (= G52), K41 (= K55), Q81 (= Q92), S134 (= S145), G136 (= G147), H191 (= H201)
- binding magnesium ion: S42 (= S56), Q81 (= Q92)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
35% identity, 83% coverage: 11:229/264 of query aligns to 2:220/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ F21), V17 (≠ I30), G38 (= G52), C39 (= C53), G40 (= G54), K41 (= K55), S42 (= S56), T43 (= T57), R128 (≠ H139), A132 (≠ Q143), S134 (= S145), Q137 (≠ M148)
- binding tetrafluoroaluminate ion: S37 (≠ T51), G38 (= G52), K41 (= K55), Q81 (= Q92), S134 (= S145), G135 (= G146), G136 (= G147), E158 (= E169), H191 (= H201)
- binding magnesium ion: S42 (= S56), Q81 (= Q92)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
35% identity, 83% coverage: 11:229/264 of query aligns to 2:220/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ F21), V17 (≠ I30), G38 (= G52), C39 (= C53), G40 (= G54), K41 (= K55), S42 (= S56), T43 (= T57), R128 (≠ H139), A132 (≠ Q143), S134 (= S145), Q137 (≠ M148)
- binding magnesium ion: S42 (= S56), Q81 (= Q92)
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
35% identity, 83% coverage: 12:229/264 of query aligns to 1:218/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ F21), S35 (≠ T51), G36 (= G52), C37 (= C53), G38 (= G54), K39 (= K55), S40 (= S56), T41 (= T57), R126 (≠ H139), A130 (≠ Q143), S132 (= S145), G134 (= G147), Q135 (≠ M148)
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
36% identity, 78% coverage: 12:216/264 of query aligns to 4:215/226 of 5xu1B
2awnC Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
36% identity, 75% coverage: 33:229/264 of query aligns to 12:190/344 of 2awnC
Sites not aligning to the query:
Query Sequence
>H281DRAFT_03799 FitnessBrowser__Burk376:H281DRAFT_03799
MNQPMSRETPAIEMRNVSCRFISPDGKATIALRDFSMSVARGEFVAIVGPTGCGKSTTLS
MITGLLKPTTGEVRVMGAPVDGIDPRIGFVFQADAVFPWRSVIDNVAAGPLYRGRSKSAA
YEEANEWLRRVGLDKFGKHYPHQLSGGMRKRVALAQTFINRPEILLMDEPFSALDMQTRT
LMQDELLQLWGGAGSVVFVTHDLEEAIALADRVFVLTARPATLKKVYEIDLPRPRVTSEV
RYDPRFIEISRDIWHDLREEVQIG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory