SitesBLAST
Comparing H281DRAFT_03815 FitnessBrowser__Burk376:H281DRAFT_03815 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ec8A E. Coli glucarate dehydratase bound to product 2,3-dihydroxy-5-oxo- hexanedioate (see paper)
75% identity, 94% coverage: 30:468/468 of query aligns to 3:442/442 of 1ec8A
- active site: K201 (= K228), K203 (= K230), D231 (= D258), N233 (= N260), E256 (= E283), N285 (= N312), M286 (= M313), D309 (= D336), H335 (= H362), N337 (= N364), I361 (= I388)
- binding 2,3-dihydroxy-5-oxo-hexanedioate: N23 (= N50), H28 (= H55), T99 (= T126), Y146 (= Y173), K203 (= K230), D231 (= D258), N233 (= N260), N285 (= N312), H335 (= H362), S336 (= S363), N337 (= N364), H364 (= H391), R418 (= R444)
- binding magnesium ion: D231 (= D258), E256 (= E283), N285 (= N312)
P0AES2 Glucarate dehydratase; GDH; GlucD; D-glucarate dehydratase; EC 4.2.1.40 from Escherichia coli (strain K12) (see 3 papers)
75% identity, 94% coverage: 30:468/468 of query aligns to 7:446/446 of P0AES2
- Y150 (= Y173) mutation to F: Reduces activity 100-fold.
- K207 (= K230) active site, Proton acceptor; mutation to Q: Reduces activity 1000-fold.; mutation to R: Reduces activity 10000-fold.
- D235 (= D258) binding
- E266 (= E289) binding
- N289 (= N312) binding
- H339 (= H362) active site, Proton acceptor; mutation to A: Loss of activity.; mutation to N: Reduces activity 10000-fold.; mutation to Q: Reduces activity 1000-fold.
- N341 (= N364) mutation to D: Inactive in the dehydration reaction of D-glucarate, L-idarate, and 4F-Gluc.; mutation to L: Almost no effect on the dehydration reaction of D-glucarate, L-idarate, and 4F-Gluc.
- D366 (= D389) mutation D->A,N: Reduces activity over 100-fold.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1ecqA E. Coli glucarate dehydratase bound to 4-deoxyglucarate (see paper)
75% identity, 94% coverage: 30:468/468 of query aligns to 5:444/444 of 1ecqA
- active site: K203 (= K228), K205 (= K230), D233 (= D258), N235 (= N260), E258 (= E283), N287 (= N312), M288 (= M313), D311 (= D336), H337 (= H362), N339 (= N364), I363 (= I388)
- binding 4-deoxyglucarate: N25 (= N50), H30 (= H55), T101 (= T126), Y148 (= Y173), F150 (= F175), K205 (= K230), D233 (= D258), N235 (= N260), N287 (= N312), H337 (= H362), S338 (= S363), N339 (= N364), H366 (= H391), R420 (= R444)
- binding magnesium ion: D233 (= D258), E258 (= E283), N287 (= N312)
1ec9D E. Coli glucarate dehydratase bound to xylarohydroxamate (see paper)
75% identity, 94% coverage: 30:468/468 of query aligns to 5:444/444 of 1ec9D
- active site: K203 (= K228), K205 (= K230), D233 (= D258), N235 (= N260), E258 (= E283), N287 (= N312), M288 (= M313), D311 (= D336), H337 (= H362), N339 (= N364), I363 (= I388)
- binding magnesium ion: D233 (= D258), E258 (= E283), N287 (= N312)
- binding xylarohydroxamate: H30 (= H55), T101 (= T126), Y148 (= Y173), F150 (= F175), K205 (= K230), D233 (= D258), N235 (= N260), N287 (= N312), H337 (= H362), S338 (= S363), N339 (= N364), H366 (= H391), R420 (= R444)
1jctA Glucarate dehydratase, n341l mutant orthorhombic form (see paper)
75% identity, 94% coverage: 30:468/468 of query aligns to 4:443/443 of 1jctA
- active site: K202 (= K228), K204 (= K230), D232 (= D258), N234 (= N260), E257 (= E283), N286 (= N312), M287 (= M313), D310 (= D336), H336 (= H362), L338 (≠ N364), I362 (= I388)
- binding d-glucarate: N24 (= N50), H29 (= H55), T100 (= T126), Y147 (= Y173), F149 (= F175), K204 (= K230), D232 (= D258), N286 (= N312), S337 (= S363), R419 (= R444)
- binding magnesium ion: D232 (= D258), E257 (= E283), N286 (= N312)
3p0wB Crystal structure of d-glucarate dehydratase from ralstonia solanacearum complexed with mg and d-glucarate
69% identity, 93% coverage: 30:466/468 of query aligns to 2:428/428 of 3p0wB
- active site: K189 (= K228), K191 (= K230), D219 (= D258), N221 (= N260), E244 (= E283), N273 (= N312), D297 (= D336), H323 (= H362), N325 (= N364)
- binding d-glucarate: H27 (= H55), Y134 (= Y173), K191 (= K230), D219 (= D258), N221 (= N260), N273 (= N312), H323 (= H362), N325 (= N364), H352 (= H391), R406 (= R444)
- binding magnesium ion: D219 (= D258), E244 (= E283), N273 (= N312)
3nxlC Crystal structure of glucarate dehydratase from burkholderia cepacia complexed with magnesium
70% identity, 93% coverage: 30:466/468 of query aligns to 2:424/425 of 3nxlC
3nfuA Crystal structure of probable glucarate dehydratase from chromohalobacter salexigens dsm 3043 complexed with magnesium
61% identity, 93% coverage: 31:467/468 of query aligns to 3:440/441 of 3nfuA
- active site: K201 (= K228), K203 (= K230), D231 (= D258), N233 (= N260), E256 (= E283), N285 (= N312), D309 (= D336), H335 (= H362), N337 (= N364)
- binding magnesium ion: D231 (= D258), N233 (= N260), E256 (= E283), D257 (= D284), N285 (= N312)
3n6hB Crystal structure of mandelate racemase/muconate lactonizing protein from actinobacillus succinogenes 130z complexed with magnesium/sulfate
61% identity, 94% coverage: 31:468/468 of query aligns to 4:430/432 of 3n6hB
- active site: K189 (= K228), K191 (= K230), D219 (= D258), N221 (= N260), E244 (= E283), N273 (= N312), D297 (= D336), H323 (= H362), N325 (= N364)
- binding magnesium ion: D219 (= D258), E244 (= E283), N273 (= N312)
3pfrA Crystal structure of d-glucarate dehydratase related protein from actinobacillus succinogenes complexed with d-glucarate
61% identity, 94% coverage: 31:468/468 of query aligns to 3:426/426 of 3pfrA
- active site: K185 (= K228), K187 (= K230), D215 (= D258), N217 (= N260), E240 (= E283), N269 (= N312), D293 (= D336), H319 (= H362), N321 (= N364)
- binding d-glucarate: N22 (= N50), H27 (= H55), Y130 (= Y173), F132 (= F175), K187 (= K230), D215 (= D258), N217 (= N260), N269 (= N312), H319 (= H362), S320 (= S363), N321 (= N364), H348 (= H391)
- binding magnesium ion: D215 (= D258), E240 (= E283), N269 (= N312)
4it1D Crystal structure of enolase pfl01_3283 (target efi-502286) from pseudomonas fluorescens pf0-1 with bound magnesium, potassium and tartrate
37% identity, 91% coverage: 33:458/468 of query aligns to 6:421/427 of 4it1D
- active site: S51 (≠ V78), D54 (≠ G81), A98 (≠ L124), Y150 (= Y173), K194 (= K228), K196 (= K230), D224 (= D258), N226 (= N260), Y247 (= Y281), E249 (= E283), T271 (= T311), N272 (= N312), M273 (= M313), D296 (= D336), H323 (= H362), S324 (= S363), N325 (= N364), C349 (≠ I388), D350 (= D389)
- binding magnesium ion: D224 (= D258), E249 (= E283), N272 (= N312)
3vc6A Crystal structure of enolase tbis_1083(target efi-502310) from thermobispora bispora dsm 43833 complexed with magnesium and formate
36% identity, 92% coverage: 33:463/468 of query aligns to 4:417/420 of 3vc6A
- active site: D52 (≠ G81), H55 (≠ I84), Y146 (= Y173), K188 (= K228), K190 (= K230), D218 (= D258), N220 (= N260), E243 (= E283), N266 (= N312), M267 (= M313), D290 (= D336), H317 (= H362), S318 (= S363), N319 (= N364), H321 (= H366), C343 (≠ I388), D344 (= D389)
- binding magnesium ion: D218 (= D258), E243 (= E283), N266 (= N312)
3va8A Crystal structure of enolase fg03645.1 (target efi-502278) from gibberella zeae ph-1 complexed with magnesium, formate and sulfate
34% identity, 92% coverage: 33:464/468 of query aligns to 13:425/427 of 3va8A
3dg6A Crystal structure of muconate lactonizing enzyme from mucobacterium smegmatis complexed with muconolactone (see paper)
26% identity, 63% coverage: 135:429/468 of query aligns to 98:360/366 of 3dg6A
- active site: M134 (= M170), K160 (= K228), K162 (= K230), D191 (= D258), N193 (= N260), E217 (= E283), D242 (≠ A304), E243 (≠ T305), S244 (≠ G306), K266 (≠ Q328), G292 (= G360), N293 (≠ S361), Q294 (≠ H362), G319 (≠ A387), E320 (≠ I388), L321 (≠ D389)
- binding magnesium ion: D191 (= D258), E217 (= E283), D242 (≠ A304)
- binding [(2S)-5-oxo-2,5-dihydrofuran-2-yl]acetic acid: M134 (= M170), K160 (= K228), K162 (= K230), D191 (= D258), N193 (= N260), D242 (≠ A304), K266 (≠ Q328), N293 (≠ S361), Q294 (≠ H362), I295 (≠ S363)
Sites not aligning to the query:
4hpnA Crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops (see paper)
26% identity, 77% coverage: 71:431/468 of query aligns to 41:372/378 of 4hpnA
- active site: G50 (= G80), R53 (≠ N83), T134 (≠ S189), K164 (= K228), K166 (= K230), D194 (= D258), N196 (= N260), E220 (= E283), G245 (≠ N312), E246 (≠ M313), T247 (≠ I314), Q267 (≠ L334), D269 (= D336), H296 (= H362), V297 (≠ S363), W298 (vs. gap), R320 (≠ K384), E329 (vs. gap), F330 (vs. gap), H334 (= H391)
- binding calcium ion: D194 (= D258), D209 (vs. gap), E220 (= E283), G237 (≠ A304), E246 (≠ M313)
Sites not aligning to the query:
2gghC The mutant a68c-d72c-nlq of deinococcus radiodurans nacylamino acid racemase (see paper)
27% identity, 72% coverage: 103:439/468 of query aligns to 74:368/370 of 2gghC
- active site: Y95 (≠ F127), S137 (≠ A188), K163 (= K228), K165 (= K230), R186 (= R254), T188 (= T256), D190 (= D258), N192 (= N260), E215 (= E283), D240 (≠ P308), E241 (≠ T309), S242 (≠ A310), K264 (≠ A335), C290 (≠ S361), G291 (≠ H362), G292 (≠ S363), M293 (≠ N364), G316 (= G383), D317 (≠ K384), T318 (≠ I385)
- binding magnesium ion: D190 (= D258), E215 (= E283)
- binding n~2~-acetyl-l-glutamine: G292 (≠ S363), M293 (≠ N364), L294 (≠ N365)
Sites not aligning to the query:
5olcC Crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans (see paper)
23% identity, 79% coverage: 60:430/468 of query aligns to 18:346/351 of 5olcC
- active site: K148 (= K228), K150 (= K230), D178 (= D258), N180 (= N260), E204 (= E283), G229 (≠ N312), E230 (≠ A315), D253 (≠ H338), H280 (vs. gap), E304 (≠ A387), E309 (≠ H391)
- binding magnesium ion: D178 (= D258), E204 (= E283), E230 (≠ A315)
2pmqB Crystal structure of a mandelate racemase/muconate lactonizing enzyme from roseovarius sp. Htcc2601 (see paper)
25% identity, 62% coverage: 134:425/468 of query aligns to 97:355/374 of 2pmqB
- active site: S135 (≠ A188), Q160 (≠ K228), K162 (= K230), D192 (= D258), E217 (= E283), D240 (vs. gap), E241 (≠ R302), K264 (≠ Q326), D291 (≠ N353), D292 (= D354), A293 (≠ T358), E316 (≠ A387), G317 (vs. gap), A318 (vs. gap), W319 (vs. gap)
- binding magnesium ion: D192 (= D258), E217 (= E283), D240 (vs. gap)
Sites not aligning to the query:
4h2hA Crystal structure of an enolase (mandalate racemase subgroup, target efi-502101) from pelagibaca bermudensis htcc2601, with bound mg and l-4-hydroxyproline betaine (betonicine) (see paper)
25% identity, 62% coverage: 134:425/468 of query aligns to 99:357/368 of 4h2hA
- active site: S137 (≠ A188), Q162 (≠ K228), K164 (= K230), D194 (= D258), E219 (= E283), D242 (vs. gap), E243 (≠ R302), K266 (≠ Q326), D293 (≠ N353), D294 (= D354), A295 (≠ T358), E318 (≠ A387), G319 (vs. gap), A320 (vs. gap), W321 (vs. gap)
- binding (2S,4R)-4-hydroxy-1,1-dimethylpyrrolidinium-2-carboxylate: Q162 (≠ K228), K164 (= K230), D242 (vs. gap), K266 (≠ Q326), A295 (≠ T358), W321 (vs. gap)
- binding magnesium ion: D194 (= D258), E219 (= E283), D242 (vs. gap)
Sites not aligning to the query:
3cb3A Crystal structure of l-talarate dehydratase from polaromonas sp. Js666 complexed with mg and l-glucarate
23% identity, 83% coverage: 39:425/468 of query aligns to 14:357/373 of 3cb3A
- active site: K24 (≠ L49), S57 (vs. gap), T143 (vs. gap), K171 (= K228), K173 (= K230), D202 (= D258), N204 (= N260), E228 (= E283), G253 (≠ N312), E254 (≠ M313), M275 (≠ L334), D277 (= D336), H304 (= H362), F305 (≠ I369), A306 (≠ S370), E324 (≠ I388)
- binding l-glucaric acid: K171 (= K228), K173 (= K230), D202 (= D258), E254 (≠ M313), H304 (= H362)
- binding magnesium ion: D202 (= D258), E228 (= E283), A243 (≠ M298), F246 (= F301), E254 (≠ M313)
Query Sequence
>H281DRAFT_03815 FitnessBrowser__Burk376:H281DRAFT_03815
LQIALLATVRLTISIGLVPMSTNPSISNDTPTVTELRVVPVAGRDSMLLNLSGAHGPYFT
RNIVILRDSAGHVGVGEVPGGENIRKTIDDARSFVVGQSIGNLQAILNKVRTQFADRDAG
GRGLQTFDLRTTIHAVTALEAALLDLLGQHLGVPVAALLGEGQQRDAVEMLGYLFYIGDR
NKTDLPYASGADARDDWDRVRTEEALTPEAVVRLAEAAQARYGFNDFKLKGGVLPGDAEI
EAVTALAERFPNARVTLDPNGAWSLAEAIRLCRDKHDVLAYAEDPCGAENGYSGREVMAE
FRRATGLPTATNMIATDWRQMGHAIQLQSVDIPLADPHFWTMQGSVRVAQMCNDWGLTWG
SHSNNHFDISLAMFTHVAAAAPGKITAIDTHWIWQDGQRLTREPLQIVGGKVKVPQKPGL
GVELDMDEIEKAHALYQQHGLGARDDGVAMQYLIPNWKFDNKRPCLVR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory