SitesBLAST
Comparing H281DRAFT_03848 FitnessBrowser__Burk376:H281DRAFT_03848 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
51% identity, 99% coverage: 5:405/406 of query aligns to 10:411/448 of Q51955
- D41 (= D36) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- D44 (= D39) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- G85 (= G80) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (= D84) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (= G87) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (= R119) mutation to A: Abolishes 4-HBA transport.
- E144 (= E139) mutation to A: Strong decrease in 4-HBA transport.
- H183 (≠ R178) mutation to A: Decrease in 4-HBA transport and chemotaxis.
- D323 (= D317) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- H328 (≠ N322) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to R: Decrease in 4-HBA transport and loss of chemotaxis.
- R386 (= R380) mutation to A: Strong decrease in 4-HBA transport.
- R398 (= R392) mutation to A: Abolishes 4-HBA transport.
Sites not aligning to the query:
- 444 H→A: No change in 4-HBA transport and chemotaxis.
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
45% identity, 98% coverage: 4:400/406 of query aligns to 2:397/452 of Q5EXK5
- D82 (= D84) mutation to A: Loss of activity.
- V311 (≠ M314) mutation to W: Loss of activity.
- D314 (= D317) mutation to A: Loss of activity.
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
36% identity, 94% coverage: 24:405/406 of query aligns to 15:362/403 of P77589
- E27 (≠ D36) mutation to A: Lack of 3HPP transport activity.; mutation to D: Slight decrease in 3HPP transport activity.
- D75 (= D84) mutation D->A,E: Lack of 3HPP transport activity.
- A272 (≠ M314) mutation to H: 30% increase in 3HPP transport activity.
- K276 (≠ R318) mutation to D: Lack of 3HPP transport activity.
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
29% identity, 90% coverage: 30:396/406 of query aligns to 48:390/444 of Q8NLB7
- D54 (= D36) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- D57 (= D39) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R85) mutation to A: Loss of transport activity.
- W309 (≠ M314) mutation to V: Loss of transport activity.
- D312 (= D317) mutation to A: Loss of transport activity.
- R313 (= R318) mutation to A: Loss of transport activity.
- I317 (≠ N322) mutation I->H,Y: Loss of transport activity.
- R386 (= R392) mutation to A: Loss of transport activity.
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
26% identity, 87% coverage: 34:385/406 of query aligns to 18:405/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
26% identity, 87% coverage: 34:385/406 of query aligns to 18:405/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
26% identity, 87% coverage: 34:385/406 of query aligns to 18:405/475 of 4gbyA
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
26% identity, 87% coverage: 34:385/406 of query aligns to 22:409/491 of P0AGF4
- F24 (≠ D36) mutation to A: Decreases xylose transport.
- G83 (= G87) mutation to A: Abolishes xylose transport.
- R133 (= R119) mutation R->C,H,L: Abolishes xylose transport.
- E153 (= E139) mutation to A: Abolishes xylose transport.
- R160 (= R146) mutation to A: Abolishes xylose transport.
- Q168 (vs. gap) binding ; mutation to A: Abolishes xylose transport.
- Q288 (≠ M269) mutation to A: Abolishes xylose transport.
- QQ 288:289 (≠ MG 269:270) binding
- Q289 (≠ G270) mutation to A: Strongly decreases xylose transport.
- N294 (≠ Y275) binding ; mutation to A: Abolishes xylose transport.
- Y298 (≠ N279) mutation to A: Abolishes xylose transport.
- N325 (≠ G306) mutation to A: No effect on xylose transport.
- G340 (vs. gap) mutation to A: Abolishes xylose transport.
- R341 (vs. gap) mutation R->A,W: Abolishes xylose transport.
- W392 (≠ M367) binding ; mutation to A: Abolishes xylose transport.
- E397 (≠ A372) mutation to A: Abolishes xylose transport.
- R404 (= R380) mutation to A: Strongly decreases xylose transport.
Sites not aligning to the query:
- 415 binding
- 416 W→A: Strongly decreases xylose transport.
Q9NSA0 Solute carrier family 22 member 11; Organic anion transporter 4; OAT4; Organic anion:dicarboxylate exchanger OAT4 from Homo sapiens (Human) (see 3 papers)
26% identity, 87% coverage: 49:402/406 of query aligns to 127:483/550 of Q9NSA0
- G241 (= G160) mutation G->L,S,V: Strongly reduced cell surface expression and estrone 3-sulfate transport.
- H305 (≠ S226) mutation to A: Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-52; A-83 and A-469.
- G400 (≠ N320) mutation G->L,S,V: Strongly reduced cell surface expression and estrone 3-sulfate transport.
- H469 (≠ L388) mutation to A: Slightly reduced estrone 3-sulfate transport. Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-52; A-83 and A-305.
Sites not aligning to the query:
- 39 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface location; when associated with Q-56; Q-63 and Q-99.
- 47 H→A: Reduced cell surface expression and estrone 3-sulfate transport. Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-52; A-83; A-305 and A-469.
- 52 H→A: Slightly reduced estrone 3-sulfate transport. Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-83; A-305 and A-469.
- 56 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface expression; when associated with Q-39; Q-63 and Q-99.
- 63 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface expression; when associated with Q-39; Q-56 and Q-99.
- 83 H→A: Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-52; A-305 and A-469.
- 99 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface expression; when associated with Q-39; Q-56 and Q-63.
Q02563 Synaptic vesicle glycoprotein 2A; Synaptic vesicle protein 2; Synaptic vesicle protein 2A from Rattus norvegicus (Rat) (see 2 papers)
30% identity, 31% coverage: 71:197/406 of query aligns to 214:338/742 of Q02563
- 321:331 (vs. 178:190, 15% identical) mutation Missing: No change in uptake of BoNT/D or BoNT/E.
Sites not aligning to the query:
- 196:200 mutation Missing: No change in uptake of C.botulinum neurotoxin type D (BoNT/D, botD) or C.botulinum neurotoxin type E (BoNT/E).
- 498 N→Q: No change in uptake of BoNT/E or C.botulinum neurotoxin type A (BoNT/A, botA) by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-548. No change in uptake of BoNT/D.
- 548 N→Q: No change in uptake of BoNT/E or BoNT/A by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-498. No change in uptake of BoNT/D.
- 570:573 RLVN→TLVQ: Restores apparent molecular weight to wild-type, does not restore uptake of BoNT/E.
- 573 N→Q: BoNT/E not taken up by mouse SV2A/SV2B knockout neurons, decreased uptake of BoNT/A; SV2A apparent molecular weight decreases. No change in uptake of BoNT/D.
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
26% identity, 45% coverage: 22:204/406 of query aligns to 14:195/430 of P0AA76
- Y29 (≠ G37) binding
- D31 (= D39) mutation to N: Loss of galactonate transport activity.
- R32 (≠ T40) binding
- Y64 (≠ L72) binding
- E118 (≠ L126) mutation to Q: Loss of galactonate transport activity.
Sites not aligning to the query:
8et8A Cryo-em structure of the organic cation transporter 1 in complex with verapamil (see paper)
25% identity, 83% coverage: 71:405/406 of query aligns to 157:486/532 of 8et8A
- binding (2S)-2-(3,4-dimethoxyphenyl)-5-{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino}-2-(propan-2-yl)pentanenitrile: K213 (≠ G127), W216 (≠ M130), Q240 (≠ F154), W353 (≠ Y267), Y360 (≠ F274), F378 (≠ P292), S381 (≠ A295), E385 (≠ S299), C449 (≠ A369), S469 (≠ L388)
Sites not aligning to the query:
8et7A Cryo-em structure of the organic cation transporter 1 in complex with diphenhydramine (see paper)
25% identity, 83% coverage: 71:405/406 of query aligns to 157:486/532 of 8et7A
Sites not aligning to the query:
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
26% identity, 45% coverage: 22:204/406 of query aligns to 6:187/393 of 6e9oA
Sites not aligning to the query:
O15244 Solute carrier family 22 member 2; Organic cation transporter 2; hOCT2 from Homo sapiens (Human) (see 8 papers)
24% identity, 84% coverage: 66:406/406 of query aligns to 154:489/555 of O15244
- M165 (≠ L77) to I: lower Vmax for MPP(+) transport; no change in transport efficiency (Vmax/Km) and clearance of cyclo(his-pro) and salsolinol; dbSNP:rs8177507
- Y169 (≠ P81) mutation to F: No change in TEA uptake.
- T201 (= T113) to M: in dbSNP:rs145450955
- Y241 (≠ M153) mutation to F: Slight decrease in TEA uptake. No change in tyrosine phosphorylation. Strong decrease in TEA uptake; when associated with F-362. Strong decrease in TEA and metformin uptake and YES1-mediated tyrosine phosphorylation; when associated with F-362 and F-377.
- Y257 (≠ W170) mutation to F: No change in TEA uptake.
- S270 (≠ A186) to A: decreased Ki value for TBA inhibition of MPP(+); no change in transport efficiency (Vmax/Km) and clearance of cyclo(his-pro) and salsolinol; dbSNP:rs316019
- Y279 (≠ L195) mutation to F: No change in TEA uptake.
- Y280 (≠ M196) mutation to F: No change in TEA uptake.
- P284 (= P200) mutation to A: Decreased TEA and metformin uptake. Decreased tyrosine phosphorylation.
- PESPR 284:288 (≠ PESIR 200:204) Proline-rich sequence
- S286 (= S202) mutation to A: No change in TEA and metformin uptake. No change in tyrosine phosphorylation.
- P287 (≠ I203) mutation to A: Decreased TEA and metformin uptake. Decreased tyrosine phosphorylation.
- Y362 (≠ F274) mutation to F: Decreased TEA uptake and YES1-mediated tyrosine phosphorylation. Strong decrease in TEA uptake; when associated with F-241. Strong decrease in TEA uptake; when associated with F-377. Strong decrease in TEA and metformin uptake and YES1-mediated tyrosine phosphorylation; when associated with F-241 and F-377.
- Y377 (≠ G289) mutation to F: Slight decrease in TEA uptake. No change in tyrosine phosphorylation. Strong decrease in TEA uptake; when associated with F-362. Strong decrease in TEA and metformin uptake and YES1-mediated tyrosine phosphorylation; when associated with F-241 and F-362.
- R400 (= R318) to C: lower Vmax and reduced Ki value for TBA inhibition of MPP(+); lower transport efficiency (Vmax/Km) and clearance of cyclo(his-pro); no change in transport efficiency (Vmax/Km) and clearance of salsolinol; dbSNP:rs8177516
- K432 (≠ M350) to Q: lower Km value for MPP(+) and reduced Ki value for TBA inhibition of MPP; no change in transport efficiency (Vmax/Km) and clearance of cyclo(his-pro) and salsolinol; dbSNP:rs8177517
- Y458 (= Y375) mutation to F: No change in TEA uptake.
Sites not aligning to the query:
- 54 P → S: in dbSNP:rs8177504
- 73 Y→F: No change in TEA uptake.
- 92 Y→F: No change in TEA uptake.
- 128 Y→F: No change in TEA uptake.
- 544 Y→F: No change in TEA uptake.
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
26% identity, 45% coverage: 22:204/406 of query aligns to 3:184/409 of 6e9nA
Sites not aligning to the query:
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
27% identity, 52% coverage: 64:275/406 of query aligns to 47:261/446 of A0A0H2VG78
- R102 (= R119) mutation to A: Loss of transport activity.
- I105 (≠ T122) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E139) mutation to A: Loss of transport activity.
- Q137 (≠ F154) mutation to A: Loss of transport activity.
- Q250 (≠ C266) mutation to A: Loss of transport activity.
- Q251 (≠ Y267) mutation to A: Loss of transport activity.
- N256 (vs. gap) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
- 357 W→A: Loss of transport activity.
O08966 Solute carrier family 22 member 1; Organic cation transporter 1; mOCT1 from Mus musculus (Mouse) (see paper)
25% identity, 52% coverage: 66:278/406 of query aligns to 154:366/556 of O08966
Sites not aligning to the query:
- 32 L→F: Increased trospium uptake. Increased trospium affinity. No change in fenoterol uptake.
- 36 Y→C: Decreased fenoterol uptake. Decreased fenoterol affinity. No change in trospium uptake. No change in terbutaline affinity.
Q63089 Solute carrier family 22 member 1; Organic cation transporter 1; rOCT1 from Rattus norvegicus (Rat) (see 4 papers)
28% identity, 41% coverage: 66:231/406 of query aligns to 154:317/556 of Q63089
- C155 (≠ A67) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-179; S-322; A-358; A-418; S-437; A-470 and A-474.
- C179 (≠ V91) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; S-322; A-358; A-418; S-437; A-470 and A-474.
- M212 (≠ V124) mutation to L: No change in TEA and MPP(+) uptake.
- V213 (≠ G125) mutation to G: Decreased TEA uptake. No change in MPP(+) uptake.
- S214 (≠ L126) mutation to G: Decreased TEA and MPP(+) uptake.
- K215 (≠ G127) mutation to Q: Loss of TEA and MPP(+) uptake activity.; mutation to R: Loss of TEA and MPP(+) uptake activity.
- G216 (≠ A128) mutation to A: Decreased TEA and MPP(+) uptake.
- S217 (≠ A129) mutation to G: No change in TEA and MPP(+) uptake.
- W218 (≠ M130) mutation to F: Decreased guanidine, histamine, serotonin and TEA uptake. No change in MPP(+) uptake. No change in TEA and MPP(+) affinity. Decreased TEA Vmax. No change in MPP(+) Vmax.; mutation to L: Decreased guanidine, histamine, serotonin, TEA and MPP(+) uptake. Decreased TEA affinity. No change in MPP(+) affinity. Decreased TEA and MPP(+) Vmax.; mutation to Y: Decreased guanidine, histamine, serotonin and TEA uptake. No change in MPP(+) uptake. Increased TEA and MPP(+) affinity. Decreased TEA and MPP(+) Vmax.
- V219 (≠ P131) mutation to L: No change in TEA and MPP(+) uptake.
- S220 (≠ N132) mutation to I: Decreased TEA and MPP(+) uptake.
- G221 (≠ A133) mutation to A: Decreased TEA and MPP(+) uptake.
- Y222 (≠ V134) mutation to F: No change in guanidine, histamine, serotonin, TEA and MPP(+) uptake. Increased TEA affinity. No change in MPP(+) affinity. Decreased TEA Vmax. No change in MPP(+) Vmax.; mutation to L: Decreased guanidine, serotonin, TEA and MPP(+) uptake. No change in histamine uptake. Increased TEA and MPP(+) affinity. Decreased TEA and MPP(+) Vmax.
- T223 (= T135) mutation to I: Decreased TEA uptake. No change in MPP(+) uptake.
- L224 (= L136) mutation to V: Decreased TEA and MPP(+) uptake.
- I225 (≠ M137) mutation to G: No change in TEA and MPP(+) uptake.
- T226 (≠ S138) mutation to A: Decreased TEA uptake. No change in MPP(+) uptake.
- E227 (= E139) mutation to D: Loss of TEA and MPP(+) uptake activity.; mutation to Q: Loss of TEA and MPP(+) uptake activity.
- F228 (= F140) mutation to I: No change in TEA and MPP(+) uptake.
- V229 (≠ C141) mutation to A: Decreased TEA and MPP(+) uptake.; mutation to L: Loss of TEA and MPP(+) uptake activity.
- S286 (= S202) mutation to A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-292; A-296; A-328 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-292; A-296; A-328 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-292; A-296; A-328 and A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-292; A-296; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-292; A-296; A-328 and A-550.
- S292 (≠ A208) mutation to A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-296; A-328 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-286; A-296; A-328 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-296; A-328 and A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-296; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-296; A-328 and A-550.
- T296 (≠ P212) mutation to A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-328; A-550. Significant increase of the ASP uptake by PKA activation. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-328; A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-328; A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-328 and A-550.
Sites not aligning to the query:
- 26 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-155; A-179; S-322; A-358; A-418; S-437; A-470 and A-474.
- 322 C→S: Reduces the activation by MMTS. Abolishes the activation by MMTs; when associated with M-451. Choline affinity is increased fivefold by MMTS. Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; A-358; A-418; S-437; A-470 and A-474. Choline affinity is increased four- to fivefold; when associated with M-451.
- 328 S→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-296 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-296 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-296; A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-296 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-296 and A-550.
- 358 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-418; S-437; A-470 and A-474.
- 418 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; S-437; A-470 and A-474.
- 437 C→S: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-470 and A-474.
- 451 C→M: Reduces the activation by MMTS. Abolishes the activation by MMTs; when associated with S-322. Abolishes the effect of MMTs on choline-induced currents. Choline affinity is not influenced by MMTS. Choline affinity is increased four- to fivefold; when associated with S-322.
- 470 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-437 and A-474.
- 474 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-437 and A-470.
- 475 D→E: Decreased MPP(+) uptake, no change in MPP(+) affinity. Decreased NMN uptake, increased NMN affinity. Decreased choline uptake, increased choline affinity.; D→N: Decreased MPP(+) uptake.; D→R: Decreased MPP(+) uptake.
- 550 T→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-296; A-328. Significant increase of the ASP uptake by PKA activation. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-296 and A-328. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-296; A-328. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-296 and A-328. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-296 and A-328.
O75751 Solute carrier family 22 member 3; Extraneuronal monoamine transporter; EMT; Organic cation transporter 3; OCT3 from Homo sapiens (Human) (see paper)
25% identity, 83% coverage: 71:406/406 of query aligns to 164:492/556 of O75751
- P289 (= P200) mutation to A: Decreased TEA uptake.
- V363 (= V272) mutation to F: Decreased TEA uptake.
- Y380 (≠ Q293) mutation to F: Decreased TEA uptake.
Query Sequence
>H281DRAFT_03848 FitnessBrowser__Burk376:H281DRAFT_03848
MEETRPVDVQVLINEHPFSPFQRLIFAMCFLIVLMDGFDTAAIGFIAPSLLQEWHIGKAA
LAPVLSAALFGLACGALLSGPLSDRLGRRVVLTSAVLLFGVSCFGSAFAFDLTQLTTLRF
ITGVGLGAAMPNAVTLMSEFCPDKRRATIVNLMFCGFPLGAALGGFLAAWMIPHFGWRSV
LLFGGAVPLLLWMLLMLKLPESIRYLVAKRQPAIKIRKVLVQISASANAAESFIMRETVE
HAAGSGGIRIALSRSFLVGSLMLWLCYFMGLVIFYGLVNWMPVLLKEAGLSPQRAALVSA
LFPLGGVGTVLCGMLMDRFNPNRVVAAAYALGAVSVYAIGQAVGNLGLLMCAVFVAGALV
NTAQASMPALAAAFYPTAGRGTGVAWMLGVGRFGGIAGSFLVAELS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory