SitesBLAST
Comparing H281DRAFT_03856 FitnessBrowser__Burk376:H281DRAFT_03856 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6d9yB Crystal structure of a short chain dehydrogenase/reductase sdr from burkholderia phymatum with partially occupied NAD
44% identity, 98% coverage: 5:246/246 of query aligns to 7:251/251 of 6d9yB
- active site: G20 (= G18), S145 (= S140), Y158 (= Y153)
- binding nicotinamide-adenine-dinucleotide: G16 (= G14), R19 (= R17), G20 (= G18), D40 (= D38), L41 (= L39), V64 (= V59), D65 (= D60), Q66 (≠ V61), A93 (= A88), S145 (= S140), Y158 (= Y153), K162 (= K157), P188 (= P183), A189 (= A184), A190 (≠ M185), A191 (≠ V186), T193 (= T188)
5h5xC Crystal structure of nadh bound carbonyl reductase from streptomyces coelicolor
42% identity, 93% coverage: 7:234/246 of query aligns to 13:245/257 of 5h5xC
- active site: G24 (= G18), S151 (= S140), Y164 (= Y153), K168 (= K157)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G14), S23 (≠ R17), G24 (= G18), I25 (= I19), D44 (= D38), F45 (≠ L39), L69 (≠ V59), D70 (= D60), N97 (= N87), A98 (= A88), Y164 (= Y153), K168 (= K157), P194 (= P183), G195 (≠ A184), I197 (≠ V186), T199 (= T188)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
37% identity, 98% coverage: 1:242/246 of query aligns to 2:241/244 of 4nbuB
- active site: G18 (= G18), N111 (≠ D112), S139 (= S140), Q149 (≠ I150), Y152 (= Y153), K156 (= K157)
- binding acetoacetyl-coenzyme a: D93 (≠ P93), K98 (≠ E99), S139 (= S140), N146 (≠ V147), V147 (≠ Q148), Q149 (≠ I150), Y152 (= Y153), F184 (≠ M185), M189 (≠ L190), K200 (≠ A201)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), N17 (≠ R17), G18 (= G18), I19 (= I19), D38 (= D38), F39 (≠ L39), V59 (= V59), D60 (= D60), V61 (= V61), N87 (= N87), A88 (= A88), G89 (= G89), I90 (= I90), T137 (≠ V138), S139 (= S140), Y152 (= Y153), K156 (= K157), P182 (= P183), F184 (≠ M185), T185 (≠ V186), T187 (= T188), M189 (≠ L190)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
37% identity, 97% coverage: 5:242/246 of query aligns to 3:244/248 of 6ixmC
- active site: G16 (= G18), S142 (= S140), Y155 (= Y153), K159 (= K157)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), S15 (≠ R17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (≠ L39), A61 (≠ V59), D62 (= D60), T63 (≠ V61), N89 (= N87), A90 (= A88), M140 (≠ V138), S142 (= S140), Y155 (= Y153), K159 (= K157), P185 (= P183), A186 (= A184), Y187 (≠ M185), I188 (≠ V186), L192 (= L190)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
37% identity, 98% coverage: 1:242/246 of query aligns to 4:249/258 of 4wecA
- active site: G21 (= G18), S143 (= S140), Q154 (= Q148), Y157 (= Y153), K161 (= K157)
- binding nicotinamide-adenine-dinucleotide: G17 (= G14), A19 (= A16), S20 (≠ R17), G21 (= G18), I22 (= I19), D41 (= D38), I42 (≠ L39), V61 (= V59), D62 (= D60), V63 (= V61), N89 (= N87), T141 (≠ V138), Y157 (= Y153), K161 (= K157), P187 (= P183), P189 (≠ M185), V190 (= V186)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
36% identity, 97% coverage: 4:242/246 of query aligns to 5:243/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), S17 (≠ A16), R18 (= R17), I20 (= I19), T40 (≠ V41), N62 (≠ D60), V63 (= V61), N89 (= N87), A90 (= A88), I92 (= I90), V139 (= V138), S141 (= S140), Y154 (= Y153), K158 (= K157), P184 (= P183), G185 (≠ A184), I187 (≠ V186), T189 (= T188), M191 (≠ L190)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
34% identity, 98% coverage: 1:242/246 of query aligns to 1:257/261 of 6zzsD
- active site: G18 (= G18), S143 (= S140), Y156 (= Y153)
- binding nicotinamide-adenine-dinucleotide: G14 (= G14), S17 (≠ R17), I19 (= I19), D38 (= D38), M39 (≠ L39), D64 (= D60), V65 (= V61), N91 (= N87), A92 (= A88), G93 (= G89), M141 (≠ V138), A142 (= A139), S143 (= S140), Y156 (= Y153), K160 (= K157), P186 (= P183), G187 (≠ A184), V189 (= V186), T191 (= T188), L193 (= L190)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ N91), S143 (= S140), N145 (≠ A142), K153 (≠ I150), Y156 (= Y153), Q197 (vs. gap)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
36% identity, 97% coverage: 5:242/246 of query aligns to 3:244/248 of 4urfB
- active site: G16 (= G18), S142 (= S140), I152 (= I150), Y155 (= Y153), K159 (= K157)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (≠ M208), R211 (≠ G209), R212 (= R210)
- binding bicarbonate ion: I92 (= I90), G94 (= G92), R109 (= R107), R179 (≠ L177), S228 (= S226)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), G14 (≠ A16), N15 (≠ R17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (≠ L39), D62 (= D60), T63 (≠ V61), N89 (= N87), A90 (= A88), G91 (= G89), I140 (≠ V138), Y155 (= Y153), K159 (= K157), P185 (= P183), A186 (= A184), I188 (≠ V186), T190 (= T188)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
36% identity, 97% coverage: 5:242/246 of query aligns to 3:244/248 of 4urfA
- active site: G16 (= G18), S142 (= S140), I152 (= I150), Y155 (= Y153), K159 (= K157)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (= I90), S93 (≠ N91), G94 (= G92), E95 (≠ P93), T97 (≠ A95), E101 (= E99), T103 (≠ P101), Q106 (≠ A104), R109 (= R107), S175 (≠ K173), G177 (≠ N175)
- binding magnesium ion: S237 (≠ F235), Y238 (≠ T236)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), G14 (≠ A16), N15 (≠ R17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (≠ L39), W41 (≠ C44), D62 (= D60), T63 (≠ V61), N89 (= N87), A90 (= A88), G91 (= G89), I140 (≠ V138), Y155 (= Y153), K159 (= K157), P185 (= P183), I188 (≠ V186), T190 (= T188)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
36% identity, 97% coverage: 5:242/246 of query aligns to 3:244/248 of 4ureB
- active site: G16 (= G18), S142 (= S140), I152 (= I150), Y155 (= Y153), K159 (= K157)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ R17), G16 (= G18), I17 (= I19), N89 (= N87), G91 (= G89), Y155 (= Y153), P185 (= P183), A186 (= A184)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
34% identity, 98% coverage: 2:242/246 of query aligns to 1:256/260 of 6zzqA
- active site: G17 (= G18), S142 (= S140), Y155 (= Y153)
- binding acetoacetic acid: Q94 (≠ N91), S142 (= S140), K152 (≠ I150), Y155 (= Y153), Q196 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G13 (= G14), S16 (≠ R17), G17 (= G18), I18 (= I19), D37 (= D38), M38 (≠ L39), D63 (= D60), V64 (= V61), N90 (= N87), A91 (= A88), G92 (= G89), M140 (≠ V138), A141 (= A139), S142 (= S140), Y155 (= Y153), K159 (= K157), Y187 (≠ M185), V188 (= V186), T190 (= T188)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
37% identity, 97% coverage: 4:242/246 of query aligns to 5:239/243 of 4i08A
- active site: G19 (= G18), N113 (≠ D112), S141 (= S140), Q151 (≠ I150), Y154 (= Y153), K158 (= K157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), S17 (≠ A16), R18 (= R17), I20 (= I19), T40 (≠ V41), N62 (≠ D60), V63 (= V61), N89 (= N87), A90 (= A88), G140 (≠ A139), S141 (= S140), Y154 (= Y153), K158 (= K157), P184 (= P183), G185 (≠ A184), T189 (= T188)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
35% identity, 97% coverage: 4:242/246 of query aligns to 2:240/244 of 6t77A
- active site: G16 (= G18), S138 (= S140), Y151 (= Y153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ A16), R15 (= R17), T37 (≠ V41), L58 (≠ V59), N59 (≠ D60), V60 (= V61), A87 (= A88), G88 (= G89), I89 (= I90)
5vmlA Crystal structure of acetoacetyl-coa reductase from burkholderia pseudomallei 1710b with bound NADP
35% identity, 96% coverage: 8:242/246 of query aligns to 3:241/245 of 5vmlA
- active site: G13 (= G18), N111 (≠ D112), S139 (= S140), Y152 (= Y153), K156 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G14), G12 (≠ R17), G13 (= G18), I14 (= I19), C33 (= C44), G34 (= G45), R39 (≠ Q47), G59 (≠ V59), N60 (≠ D60), V61 (= V61), N87 (= N87), G89 (= G89), I90 (= I90), S139 (= S140), Y152 (= Y153), K156 (= K157), P182 (= P183), G183 (≠ A184), I185 (≠ V186)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
35% identity, 97% coverage: 4:242/246 of query aligns to 2:240/244 of P0A2C9
- M125 (= M127) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A225) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S226) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
39% identity, 97% coverage: 5:242/246 of query aligns to 6:244/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G14), R18 (= R17), G19 (= G18), I20 (= I19), D39 (= D38), R40 (≠ L39), C63 (≠ P53), I65 (≠ H55), N91 (= N87), G93 (= G89), I94 (= I90), V114 (= V111), Y155 (= Y153), K159 (= K157), I188 (≠ V186), T190 (= T188), T193 (≠ L191)
2q2qD Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida (see paper)
36% identity, 97% coverage: 4:242/246 of query aligns to 1:251/255 of 2q2qD
- active site: G15 (= G18), S138 (= S140), Y151 (= Y153), K155 (= K157), R196 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), T13 (≠ A16), S14 (≠ R17), G15 (= G18), I16 (= I19), F36 (≠ L39), D59 (= D60), L60 (≠ V61), N86 (= N87), G88 (= G89), L109 (≠ V111), I136 (≠ V138), S138 (= S140), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (≠ A184), W183 (≠ M185), V184 (= V186), T186 (= T188), L188 (= L190), V189 (≠ L191)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
34% identity, 97% coverage: 4:242/246 of query aligns to 2:240/244 of P0AEK2
- GASR 12:15 (≠ GAAR 14:17) binding
- T37 (≠ V41) binding
- NV 59:60 (≠ DV 60:61) binding
- N86 (= N87) binding
- Y151 (= Y153) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YSAAK 153:157) binding
- A154 (= A156) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K157) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ V186) binding
- E233 (≠ F235) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
34% identity, 97% coverage: 4:242/246 of query aligns to 1:239/243 of 1q7bA
- active site: G15 (= G18), E101 (≠ A104), S137 (= S140), Q147 (≠ I150), Y150 (= Y153), K154 (= K157)
- binding calcium ion: E232 (≠ F235), T233 (= T236)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G14), S13 (≠ A16), R14 (= R17), T36 (≠ V41), N58 (≠ D60), V59 (= V61), N85 (= N87), A86 (= A88), G87 (= G89), I88 (= I90), S137 (= S140), Y150 (= Y153), K154 (= K157), P180 (= P183), G181 (≠ A184), I183 (≠ V186)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
33% identity, 97% coverage: 4:242/246 of query aligns to 1:239/243 of 1q7cA
- active site: G15 (= G18), S137 (= S140), Q147 (≠ I150), F150 (≠ Y153), K154 (= K157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G14), S13 (≠ A16), R14 (= R17), A35 (≠ D40), T36 (≠ V41), L57 (≠ V59), N58 (≠ D60), V59 (= V61), G87 (= G89), I88 (= I90)
Query Sequence
>H281DRAFT_03856 FitnessBrowser__Burk376:H281DRAFT_03856
MTRSLDGKVAIVTGAARGIGLGIAQKLKADGARVAVWDLDVSDCGAQRLQFEPDHIQQVD
VASISSVEQAFAVTLGTLGQVDILVNNAGINGPVAPCWEYPVDAWQRVIAVDLNSVFYCC
RVAIPHMRARGGGRIVNVASIAGKEGVQFISGYSAAKAGVIAFTKAAAKELAKDNVLINC
VAPAMVETELLSEMSDAHIEASKAKIPMGRFLQIDEVGAMVSWIASPECSFTSGFTFDLT
GGRATY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory