Comparing H281DRAFT_03877 FitnessBrowser__Burk376:H281DRAFT_03877 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ywhA Crystal structure of an abc transporter solute binding protein (ipr025997) from actinobacillus succinogenes 130z (asuc_0499, target efi-511068) with bound d-xylose
63% identity, 87% coverage: 38:336/342 of query aligns to 6:305/310 of 4ywhA
3ma0A Closed liganded crystal structure of xylose binding protein from escherichia coli (see paper)
62% identity, 89% coverage: 37:339/342 of query aligns to 4:307/313 of 3ma0A
3uugA Crystal structure of the periplasmic sugar binding protein chve (see paper)
36% identity, 89% coverage: 34:339/342 of query aligns to 1:328/329 of 3uugA
3urmA Crystal structure of the periplasmic sugar binding protein chve (see paper)
36% identity, 89% coverage: 34:339/342 of query aligns to 1:328/329 of 3urmA
4ys6A Crystal structure of an abc transporter solute binding protein (ipr025997) from clostridium phytofermentans (cphy_1585, target efi- 511156) with bound beta-d-glucose
34% identity, 88% coverage: 38:339/342 of query aligns to 3:323/324 of 4ys6A
4wwhA Crystal structure of an abc transporter solute binding protein (ipr025997) from mycobacterium smegmatis (msmeg_1704, target efi- 510967) with bound d-galactose
37% identity, 88% coverage: 38:339/342 of query aligns to 5:328/329 of 4wwhA
4rxuA Crystal structure of carbohydrate transporter solute binding protein caur_1924 from chloroflexus aurantiacus, target efi-511158, in complex with d-glucose
33% identity, 93% coverage: 24:341/342 of query aligns to 4:338/340 of 4rxuA
6s3tA P46, an immunodominant surface protein from mycoplasma hyopneumoniae (see paper)
29% identity, 85% coverage: 38:326/342 of query aligns to 15:372/374 of 6s3tA
6ruxA P46, an immunodominant surface protein from mycoplasma hyopneumoniae (see paper)
29% identity, 85% coverage: 38:326/342 of query aligns to 13:370/373 of 6ruxA
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
32% identity, 77% coverage: 38:299/342 of query aligns to 3:260/274 of 2ioyA
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
31% identity, 70% coverage: 34:273/342 of query aligns to 1:244/287 of 5dteB
Sites not aligning to the query:
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
32% identity, 63% coverage: 79:295/342 of query aligns to 50:263/287 of 4yo7A
Sites not aligning to the query:
4ry9B Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
28% identity, 85% coverage: 37:326/342 of query aligns to 4:288/297 of 4ry9B
4ry9A Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
28% identity, 85% coverage: 37:326/342 of query aligns to 4:288/297 of 4ry9A
4rxmB Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
30% identity, 63% coverage: 58:272/342 of query aligns to 25:238/288 of 4rxmB
Sites not aligning to the query:
4rxmA Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
30% identity, 63% coverage: 58:272/342 of query aligns to 27:240/291 of 4rxmA
Sites not aligning to the query:
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
29% identity, 71% coverage: 53:296/342 of query aligns to 13:256/270 of 4zjpA
A0QYB3 Xylitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
29% identity, 76% coverage: 72:330/342 of query aligns to 70:312/349 of A0QYB3
Sites not aligning to the query:
5hkoA Crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with l-sorbitol
29% identity, 76% coverage: 72:330/342 of query aligns to 37:279/314 of 5hkoA
Sites not aligning to the query:
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
29% identity, 76% coverage: 72:330/342 of query aligns to 37:279/315 of 4rs3A
Sites not aligning to the query:
>H281DRAFT_03877 FitnessBrowser__Burk376:H281DRAFT_03877
MKFATRRTVLGSLVCGAVLASLSLAAPLAHASKDHPEIGFCIDDLRVERWSRDRDYFVAA
AEKLGAKVSVQSADASEARQISQIENLISRGVDVIVIVPFNSKTLGNVVAEARKAGIKVV
SYDRLILDADVDAYISFDNEKVGELQAEGVYKAQPKGNYFLLGGAPTDNNAKMLREGQLK
VLKPAIDKGDIKLVGQQWVPEWSASTALRIVEDALTANNNKIDAIVASNDGTAGGAIQAL
AAQHMAGKVPVSGQDADLAAVKRLIAGTQTMTVYKPLKLIAGEAAKLSVALAKGEKPAFN
AQYDNGKKKVDTVLLQPTLLTKSNVDVVIKDGFYTQAQLASQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory