Comparing H281DRAFT_03878 FitnessBrowser__Burk376:H281DRAFT_03878 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
46% identity, 98% coverage: 3:510/519 of query aligns to 2:498/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 43% coverage: 4:227/519 of query aligns to 1:217/241 of 4u00A
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 47% coverage: 2:243/519 of query aligns to 1:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
26% identity, 47% coverage: 2:244/519 of query aligns to 1:254/254 of 1g6hA
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 42% coverage: 4:222/519 of query aligns to 16:225/378 of P69874
Sites not aligning to the query:
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
27% identity, 46% coverage: 6:246/519 of query aligns to 3:238/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
27% identity, 46% coverage: 6:246/519 of query aligns to 3:238/238 of 6s8gA
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
30% identity, 45% coverage: 3:238/519 of query aligns to 1:232/250 of 7z18I
6mbnA Lptb e163q in complex with atp (see paper)
27% identity, 47% coverage: 6:247/519 of query aligns to 4:240/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
29% identity, 42% coverage: 6:225/519 of query aligns to 3:216/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
29% identity, 42% coverage: 6:225/519 of query aligns to 3:216/234 of 4p31A
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
28% identity, 46% coverage: 6:243/519 of query aligns to 3:235/235 of 6mhzA
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
30% identity, 45% coverage: 3:238/519 of query aligns to 1:232/253 of 7z15I
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
29% identity, 42% coverage: 6:225/519 of query aligns to 3:216/233 of 6b8bA
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
30% identity, 45% coverage: 3:238/519 of query aligns to 1:232/250 of 7z16I
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
31% identity, 44% coverage: 3:228/519 of query aligns to 2:226/650 of 5ws4A
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
28% identity, 47% coverage: 6:251/519 of query aligns to 4:243/369 of P19566
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 42% coverage: 5:221/519 of query aligns to 1:217/343 of P30750
Sites not aligning to the query:
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
25% identity, 47% coverage: 5:247/519 of query aligns to 2:239/240 of 6mjpA
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
29% identity, 42% coverage: 5:221/519 of query aligns to 2:218/344 of 6cvlD
>H281DRAFT_03878 FitnessBrowser__Burk376:H281DRAFT_03878
MTQPLLTMRGIVKAFSGVKALDGIDLTVSPGECVGLCGENGAGKSTLMKVLSGVYPHGTW
DGEITWEGKPLKATSIRDTERAGIIIIHQELMLVPELSVAENIFLGNEITLPGGRMNYAA
MYQRADELLRELGISGINAAQPVMNYGGGHQQLIEIAKALNKQAKLLILDEPSSSLTSSE
IAILLDIVRDLKRRGVACVYISHKLDEVAAVCDTISVIRDGRHVATEPMHALTTDRIISL
MVGREIKNLFPREPHPIGDVIFEARNVTCFDVTNPRRKRVSDVSFELRRGEILGVAGLVG
AGRTELMQAIFGAYPGVSEATVVMEGKTVKIRAPIDAIRAGIGMVPEDRKRHGIVPGLSV
GHNITLAVLQRFSSGGRIDSAAELDTIHTEMKRLSVRAAHPMLSIASLSGGNQQKAVLTR
MLLTDPKVLILDEPTRGVDVGAKFEIYKLIFQLAQRGMSIVMVSSELPEVLGISDRVLVI
GEGELRGDFVNDGLTQEDILSAAIRPVQRVPNPTAASAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory