SitesBLAST
Comparing H281DRAFT_03881 FitnessBrowser__Burk376:H281DRAFT_03881 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3B Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
53% identity, 97% coverage: 4:150/152 of query aligns to 5:151/154 of 8gy3B
- binding fe2/s2 (inorganic) cluster: G38 (= G37), C39 (= C38), G40 (= G39), G42 (= G41), C44 (= C43), G45 (= G44), C47 (= C46), C59 (= C58), C97 (= C96), C100 (= C99), Q101 (= Q100), C132 (= C131), C134 (= C133)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q96 (= Q95), C134 (= C133)
5y6qA Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
39% identity, 95% coverage: 3:147/152 of query aligns to 6:152/157 of 5y6qA
- binding fe2/s2 (inorganic) cluster: G40 (= G37), C41 (= C38), D42 (≠ G39), G44 (= G41), C46 (= C43), G47 (= G44), C49 (= C46), C61 (= C58), C101 (= C96), G102 (= G97), C104 (= C99), C136 (= C131), C138 (= C133)
- binding pterin cytosine dinucleotide: Q100 (= Q95), C138 (= C133)
Q0QLF3 Nicotinate dehydrogenase small FeS subunit; NDH; Nicotinic acid hydroxylase small FeS subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
39% identity, 97% coverage: 3:149/152 of query aligns to 7:154/157 of Q0QLF3
- C42 (= C38) binding
- C47 (= C43) binding
- C50 (= C46) binding
- C62 (= C58) binding
- C101 (= C96) binding
- C104 (= C99) binding
- C136 (= C131) binding
- C138 (= C133) binding
3hrdD Crystal structure of nicotinate dehydrogenase (see paper)
39% identity, 97% coverage: 3:149/152 of query aligns to 7:154/160 of 3hrdD
- binding flavin-adenine dinucleotide: E44 (≠ V40), G45 (= G41), E46 (≠ I42)
- binding fe2/s2 (inorganic) cluster: E40 (≠ F36), C42 (= C38), S43 (≠ G39), G45 (= G41), C47 (= C43), G48 (= G44), C50 (= C46), C62 (= C58), Q100 (= Q95), C101 (= C96), G102 (= G97), C104 (= C99), C136 (= C131), C138 (= C133)
- binding pterin cytosine dinucleotide: Q100 (= Q95), C138 (= C133)
1sb3C Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
39% identity, 97% coverage: 4:150/152 of query aligns to 7:154/161 of 1sb3C
- binding fe2/s2 (inorganic) cluster: Q39 (≠ F36), C41 (= C38), G44 (= G41), C46 (= C43), G47 (= G44), C49 (= C46), C61 (= C58), C100 (= C96), G101 (= G97), C103 (= C99), C135 (= C131), C137 (= C133)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q95), C137 (= C133)
4zohC Crystal structure of glyceraldehyde oxidoreductase (see paper)
37% identity, 97% coverage: 3:149/152 of query aligns to 13:159/161 of 4zohC
- binding fe2/s2 (inorganic) cluster: C47 (= C38), S50 (≠ G41), C52 (= C43), G53 (= G44), C55 (= C46), C67 (= C58), C106 (= C96), G107 (= G97), C109 (= C99), C141 (= C131), C143 (= C133)
- binding pterin cytosine dinucleotide: Q105 (= Q95), C143 (= C133)
1ffvA Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
32% identity, 97% coverage: 3:149/152 of query aligns to 5:152/155 of 1ffvA
- binding fe2/s2 (inorganic) cluster: I38 (≠ F36), C40 (= C38), S43 (≠ G41), C45 (= C43), G46 (= G44), C48 (= C46), C60 (= C58), C99 (= C96), G100 (= G97), C102 (= C99), C134 (= C131), C136 (= C133)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q98 (= Q95), C136 (= C133)
1ffuD Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
32% identity, 97% coverage: 3:149/152 of query aligns to 6:153/156 of 1ffuD
- binding fe2/s2 (inorganic) cluster: C41 (= C38), S44 (≠ G41), H45 (≠ I42), C46 (= C43), G47 (= G44), C49 (= C46), C61 (= C58), C100 (= C96), G101 (= G97), C103 (= C99), C135 (= C131), C137 (= C133)
1t3qA Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
36% identity, 99% coverage: 3:152/152 of query aligns to 7:162/162 of 1t3qA
- binding fe2/s2 (inorganic) cluster: I40 (≠ F36), C42 (= C38), E43 (≠ G39), G45 (= G41), C47 (= C43), G48 (= G44), C50 (= C46), R60 (≠ L56), C62 (= C58), C101 (= C96), G102 (= G97), C104 (= C99), C136 (= C131), C138 (= C133)
- binding pterin cytosine dinucleotide: Q100 (= Q95), C138 (= C133)
P77165 Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA; EC 1.2.99.6 from Escherichia coli (strain K12) (see paper)
36% identity, 95% coverage: 3:147/152 of query aligns to 64:224/229 of P77165
- C99 (= C38) binding
- C104 (= C43) binding
- G105 (= G44) binding
- C107 (= C46) binding
- C119 (= C58) binding
- C158 (= C96) binding
- C161 (= C99) binding
- C208 (= C131) binding
- C210 (= C133) binding
1n5wD Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
36% identity, 97% coverage: 3:149/152 of query aligns to 5:153/158 of 1n5wD
- binding flavin-adenine dinucleotide: S43 (≠ G41), H44 (≠ I42)
- binding fe2/s2 (inorganic) cluster: C40 (= C38), S43 (≠ G41), C45 (= C43), G46 (= G44), C48 (= C46), C60 (= C58), C100 (= C96), G101 (= G97), C103 (= C99), C135 (= C131), C137 (= C133)
- binding pterin cytosine dinucleotide: Q99 (= Q95), C137 (= C133)
1n5wA Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
36% identity, 97% coverage: 3:149/152 of query aligns to 5:153/161 of 1n5wA
- binding flavin-adenine dinucleotide: S43 (≠ G41), H44 (≠ I42)
- binding fe2/s2 (inorganic) cluster: I38 (≠ F36), G39 (= G37), C40 (= C38), S43 (≠ G41), C45 (= C43), G46 (= G44), C48 (= C46), C60 (= C58), C100 (= C96), G101 (= G97), C103 (= C99), C135 (= C131), C137 (= C133)
P19921 Carbon monoxide dehydrogenase small chain; CO dehydrogenase subunit S; CO-DH S; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
36% identity, 97% coverage: 3:149/152 of query aligns to 7:155/166 of P19921
- C42 (= C38) binding
- C47 (= C43) binding
- C50 (= C46) binding
- C62 (= C58) binding
- C102 (= C96) binding
- C105 (= C99) binding
- C137 (= C131) binding
- C139 (= C133) binding
5g5gA Escherichia coli periplasmic aldehyde oxidase (see paper)
36% identity, 95% coverage: 3:147/152 of query aligns to 13:173/175 of 5g5gA
- binding fe2/s2 (inorganic) cluster: G47 (= G37), C48 (= C38), D49 (≠ G39), G51 (= G41), C53 (= C43), G54 (= G44), C56 (= C46), C68 (= C58), C107 (= C96), G108 (= G97), C110 (= C99), C157 (= C131), C159 (= C133)
1dgjA Crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 (see paper)
35% identity, 96% coverage: 2:147/152 of query aligns to 4:153/906 of 1dgjA
- binding fe2/s2 (inorganic) cluster: V38 (≠ F36), G39 (= G37), C40 (= C38), G41 (= G39), G43 (= G41), Q44 (≠ I42), C45 (= C43), G46 (= G44), C48 (= C46), R58 (≠ L56), C60 (= C58), C100 (= C96), G101 (= G97), C103 (= C99), C137 (= C131), C139 (= C133)
- binding pterin cytosine dinucleotide: Q99 (= Q95), C139 (= C133)
Sites not aligning to the query:
- active site: 391, 427, 503, 507, 535, 869, 870
- binding molybdenum (iv)oxide: 424, 535, 698, 869
- binding pterin cytosine dinucleotide: 423, 424, 535, 652, 655, 656, 657, 658, 697, 698, 700, 702, 703, 799, 800, 803, 804, 807, 865, 866, 867, 868, 869
2ckjA Human milk xanthine oxidoreductase
35% identity, 86% coverage: 6:136/152 of query aligns to 8:151/1264 of 2ckjA
- binding fe2/s2 (inorganic) cluster: G40 (= G37), C41 (= C38), G42 (= G39), G44 (= G41), C46 (= C43), G47 (= G44), C49 (= C46), C71 (= C58), C111 (= C96), G112 (= G97), C114 (= C99), C146 (= C131), R147 (= R132), C148 (= C133)
Sites not aligning to the query:
- active site: 711, 746, 824, 828, 856, 1204, 1205
- binding flavin-adenine dinucleotide: 228, 230, 231, 232, 233, 234, 308, 309, 317, 318, 321, 322, 324, 325, 331, 375
2e1qA Crystal structure of human xanthine oxidoreductase mutant, glu803val (see paper)
35% identity, 86% coverage: 6:136/152 of query aligns to 8:151/1307 of 2e1qA
- binding flavin-adenine dinucleotide: E43 (≠ V40), G44 (= G41)
- binding fe2/s2 (inorganic) cluster: G40 (= G37), C41 (= C38), G42 (= G39), G44 (= G41), C46 (= C43), G47 (= G44), C49 (= C46), C71 (= C58), Q110 (= Q95), C111 (= C96), G112 (= G97), C114 (= C99), C146 (= C131), C148 (= C133)
Sites not aligning to the query:
- active site: 742, 777, 855, 859, 887, 1235, 1236
- binding bicarbonate ion: 814, 815, 852, 886, 889, 890, 893
- binding calcium ion: 715, 716, 718, 741, 747, 780, 781, 784, 811, 812
- binding flavin-adenine dinucleotide: 230, 231, 232, 233, 234, 235, 236, 237, 238, 311, 312, 316, 320, 321, 324, 325, 327, 328, 333, 334, 377, 378
- binding fe2/s2 (inorganic) cluster: 719
- binding hydroxy(dioxo)molybdenum: 773, 774, 887, 1053, 1054, 1236
3am9A Complex of bovine xanthine dehydrogenase and trihydroxy fyx-051 (see paper)
33% identity, 94% coverage: 6:148/152 of query aligns to 8:163/1293 of 3am9A
- binding flavin-adenine dinucleotide: E43 (≠ V40), G44 (= G41)
- binding fe2/s2 (inorganic) cluster: G40 (= G37), C41 (= C38), G42 (= G39), G44 (= G41), C46 (= C43), G47 (= G44), C49 (= C46), C71 (= C58), C111 (= C96), G112 (= G97), C114 (= C99), C146 (= C131), C148 (= C133)
Sites not aligning to the query:
- active site: 733, 768, 846, 850, 878, 1226, 1227
- binding bicarbonate ion: 805, 806, 875, 876, 877, 884
- binding calcium ion: 707, 709, 802, 803, 833, 836, 837, 840, 873, 874
- binding flavin-adenine dinucleotide: 228, 229, 231, 232, 233, 234, 235, 236, 309, 310, 314, 318, 319, 322, 323, 325, 326, 332, 376, 394
- binding fe2/s2 (inorganic) cluster: 710
- binding 4-[5-(2,6-dioxo-1,2,3,6-tetrahydropyridin-4-yl)-1H-1,2,4-triazol-3-yl]-6-oxo-1,6-dihydropyridine-2-carbonitrile: 614, 768, 839, 842, 846, 880, 975, 980, 1045, 1227
1n5xA Xanthine dehydrogenase from bovine milk with inhibitor tei-6720 bound (see paper)
33% identity, 94% coverage: 6:148/152 of query aligns to 8:163/1290 of 1n5xA
- binding flavin-adenine dinucleotide: E43 (≠ V40), G44 (= G41)
- binding fe2/s2 (inorganic) cluster: G40 (= G37), C41 (= C38), G42 (= G39), G44 (= G41), C46 (= C43), G47 (= G44), C49 (= C46), C71 (= C58), Q110 (= Q95), C111 (= C96), G112 (= G97), C114 (= C99), C146 (= C131), C148 (= C133)
Sites not aligning to the query:
- active site: 734, 769, 847, 851, 879, 1227, 1228
- binding flavin-adenine dinucleotide: 229, 231, 232, 233, 234, 235, 236, 309, 310, 318, 319, 322, 323, 325, 326, 332, 376
- binding fe2/s2 (inorganic) cluster: 711
- binding 2-(3-cyano-4-isobutoxy-phenyl)-4-methyl-5-thiazole-carboxylic acid: 615, 738, 769, 840, 847, 881, 976, 977, 978, 981
3amzA Bovine xanthine oxidoreductase urate bound form (see paper)
33% identity, 94% coverage: 6:148/152 of query aligns to 8:163/1291 of 3amzA
- binding flavin-adenine dinucleotide: G44 (= G41)
- binding fe2/s2 (inorganic) cluster: G40 (= G37), C41 (= C38), G42 (= G39), G44 (= G41), C46 (= C43), G47 (= G44), C49 (= C46), C71 (= C58), Q110 (= Q95), C111 (= C96), G112 (= G97), C114 (= C99), C146 (= C131), C148 (= C133)
Sites not aligning to the query:
- active site: 731, 766, 844, 848, 876, 1224, 1225
- binding bicarbonate ion: 803, 804, 873, 874, 878, 879, 882
- binding calcium ion: 831, 834, 835, 838, 871, 872
- binding flavin-adenine dinucleotide: 229, 230, 231, 232, 233, 234, 235, 236, 309, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 708
- binding 1,4-dihydronicotinamide adenine dinucleotide: 328, 329, 330, 365, 366, 402, 403, 430, 432, 433, 473, 480, 1189
- binding uric acid: 766, 844, 878, 973, 974, 1043, 1225
Query Sequence
>H281DRAFT_03881 FitnessBrowser__Burk376:H281DRAFT_03881
MRSLNINGRAVAVQAEPDMPLLWVLRCELGMTGTKFGCGVGICGACTVHLNDKPCLSCQT
PMSTLNTQKITTIEGMQGAEAQALRAAWIDLDVVQCGYCQSAQLMAACALLKQKPRPTDA
DIDAAMSNIVCRCGTYPRVRAAIHEAAKRRPV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory