SitesBLAST
Comparing H281DRAFT_03942 FitnessBrowser__Burk376:H281DRAFT_03942 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6tg9A Cryo-em structure of nadh reduced form of NAD+-dependent formate dehydrogenase from rhodobacter capsulatus (see paper)
68% identity, 94% coverage: 38:960/983 of query aligns to 8:938/949 of 6tg9A
- active site: K289 (= K311), C380 (= C402), H381 (= H403), L545 (= L567), G582 (= G604), Q583 (= Q605)
- binding fe2/s2 (inorganic) cluster: C51 (= C82), V59 (≠ F90), G60 (= G91), C62 (= C93), C65 (= C96), C79 (= C110)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: C255 (= C277), K289 (= K311), R351 (= R373), C352 (= C374), C380 (= C402), G414 (= G436), A415 (= A437), D419 (= D441), G420 (= G442), H421 (= H443), P443 (= P465), R444 (= R466), P464 (= P486), N467 (= N489), L545 (= L567), G546 (= G568), H550 (= H572), G582 (= G604), Q583 (= Q605), Q583 (= Q605), G649 (= G671), E650 (= E672), S655 (= S677), N680 (= N702), S693 (= S715), K698 (= K720), D724 (= D746), T820 (= T842), T821 (= T843), R823 (= R845), R823 (= R845), I824 (= I846), L825 (= L847), N829 (= N851), V830 (= V852), Q833 (= Q855), N902 (= N924), Y918 (= Y940), K919 (= K941)
- binding iron/sulfur cluster: H111 (= H142), C115 (= C146), C118 (= C149), A120 (= A151), C124 (= C155), C176 (= C197), I177 (= I198), V178 (= V199), C179 (= C200), M180 (≠ N201), C182 (= C203), C186 (= C207), I206 (≠ V227), C218 (= C240), S220 (= S242), C221 (= C243), G222 (= G244), C224 (= C246), C228 (= C250), T230 (= T252), A231 (= A253), C252 (= C274), Y254 (= Y276), C255 (= C277), V257 (= V279), C259 (= C281), F261 (= F283), C287 (= C309), K289 (= K311), V423 (= V445)
7vw6A Cryo-em structure of formate dehydrogenase 1 from methylorubrum extorquens am1 (see paper)
36% identity, 92% coverage: 50:949/983 of query aligns to 2:912/913 of 7vw6A
- binding fe2/s2 (inorganic) cluster: H32 (≠ K80), C34 (= C82), H35 (vs. gap), G45 (= G91), C47 (= C93), R48 (= R94), C50 (= C96), C64 (= C110)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K263 (= K311), K339 (≠ R373), C364 (= C398), C368 (= C402), G402 (= G436), N404 (= N438), N408 (≠ G442), D431 (= D464), P432 (= P465), R433 (= R466), F447 (≠ L484), G450 (= G487), D452 (≠ N489), G525 (= G566), M526 (≠ L567), G527 (= G568), Q530 (≠ E571), H531 (= H572), G563 (= G604), Q564 (= Q605), G630 (= G671), N632 (≠ D673), S636 (= S677), Q656 (= Q697), D657 (= D698), L658 (≠ I699), T805 (= T843), R807 (= R845), R807 (= R845), V808 (≠ I846), L809 (= L847), H811 (≠ Q849), W812 (≠ Y850), H813 (≠ N851), H813 (≠ N851), T814 (≠ V852), M817 (≠ Q855), F879 (= F916), N887 (= N924), F903 (≠ Y940), K904 (= K941)
- binding iron/sulfur cluster: C145 (= C197), I146 (= I198), Q147 (≠ V199), C148 (= C200), N149 (= N201), C151 (= C203), C155 (= C207), N161 (≠ T213), V163 (≠ A215), I164 (≠ L216), V175 (= V227), C188 (= C240), V189 (= V241), A190 (≠ S242), C191 (= C243), G192 (= G244), C194 (= C246), C198 (= C250), P199 (= P251), T200 (= T252), A202 (≠ T254), L203 (= L255), C227 (= C274), C230 (= C277), C234 (= C281), C261 (= C309), K263 (= K311), G264 (= G312), V411 (= V445)
1fdiA Oxidized form of formate dehydrogenase h from e. Coli complexed with the inhibitor nitrite (see paper)
37% identity, 72% coverage: 270:974/983 of query aligns to 4:708/715 of 1fdiA
- active site: C11 (= C277), L41 (≠ A308), C42 (= C309), K44 (= K311), S108 (= S371), R110 (= R373), D134 (= D396), C140 (= C402), H141 (= H403), S180 (≠ G442), M297 (≠ L567), R333 (= R603), G334 (= G604), Q335 (= Q605)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K44 (= K311), R110 (= R373), G111 (≠ C374), V139 (= V401), C140 (= C402), F173 (≠ I435), G174 (= G436), Y175 (≠ A437), N176 (= N438), D179 (= D441), S180 (≠ G442), C201 (≠ V463), D202 (= D464), P203 (= P465), R204 (= R466), L218 (= L484), G221 (= G487), N223 (= N489), G296 (= G566), M297 (≠ L567), G298 (= G568), F302 (≠ H572), G334 (= G604), Q335 (= Q605), Q335 (= Q605), G402 (= G671), E403 (= E672), T408 (≠ S677), Q428 (= Q697), D429 (= D698), I430 (= I699), S445 (≠ G714), D478 (= D746), T579 (= T843), V580 (≠ G844), R581 (= R845), R581 (= R845), E582 (≠ I846), H585 (≠ Q849), Y586 (= Y850), S587 (≠ N851), C588 (≠ V852), Y654 (≠ F916), N662 (= N924), Y678 (= Y940), K679 (= K941)
- binding nitrite ion: C140 (= C402), H141 (= H403), R333 (= R603), G334 (= G604), V338 (= V608)
- binding iron/sulfur cluster: C8 (= C274), Y10 (= Y276), C11 (= C277), S13 (≠ V279), C15 (= C281), L41 (≠ A308), C42 (= C309), K44 (= K311), P182 (= P444), I183 (≠ V445)
P07658 Formate dehydrogenase H; Formate dehydrogenase-H subunit alpha; FDH-H; Formate-hydrogen-lyase-linked, selenocysteine-containing polypeptide; EC 1.17.98.4 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 72% coverage: 270:974/983 of query aligns to 4:708/715 of P07658
- C8 (= C274) binding
- Y10 (= Y276) binding
- C11 (= C277) binding
- C15 (= C281) binding
- C42 (= C309) binding
- K44 (= K311) binding
- U140 (≠ C402) modified: nonstandard, Selenocysteine
- M297 (≠ L567) binding
- Q301 (≠ E571) binding
- Q335 (= Q605) binding
- S445 (≠ G714) binding
- D478 (= D746) binding
- C588 (≠ V852) binding
- Y654 (≠ F916) binding
- Q655 (≠ H917) binding
- Y678 (= Y940) binding
- K679 (= K941) binding
2iv2X Reinterpretation of reduced form of formate dehydrogenase h from e. Coli (see paper)
37% identity, 72% coverage: 270:974/983 of query aligns to 4:690/697 of 2iv2X
- active site: C11 (= C277), L41 (≠ A308), C42 (= C309), K44 (= K311), S108 (= S371), C140 (= C402), H141 (= H403), S180 (≠ G442), M297 (≠ L567), R333 (= R603), G334 (= G604), Q335 (= Q605)
- binding guanylate-o'-phosphoric acidmono-(2-amino-5,6-dimercapto-4-oxo-3,5,6,7,8a,9,10,10a-octahydro-4h-8-oxa-1,3,9,10-tetraaza-anthracen-7-ylmethyl) ester: R110 (= R373), G111 (≠ C374), T112 (= T375), A137 (= A399), Q335 (= Q605), G402 (= G671), E403 (= E672), D404 (= D673), T408 (≠ S677), A410 (≠ P679), Q428 (= Q697), D429 (= D698), I430 (= I699), S445 (≠ G714), D478 (= D746), C588 (≠ V852), Y660 (= Y940)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K44 (= K311), F173 (≠ I435), G174 (= G436), Y175 (≠ A437), N176 (= N438), D179 (= D441), S180 (≠ G442), D202 (= D464), P203 (= P465), R204 (= R466), N223 (= N489), G296 (= G566), M297 (≠ L567), F302 (≠ H572), G334 (= G604), R581 (= R845), E582 (≠ I846), V583 (≠ L847), H585 (≠ Q849), Y586 (= Y850), S587 (≠ N851), K661 (= K941)
- binding iron/sulfur cluster: C8 (= C274), C11 (= C277), S13 (≠ V279), C15 (= C281), L41 (≠ A308), C42 (= C309), K44 (= K311), G45 (= G312), I183 (≠ V445)
7qv7S Cryo-em structure of hydrogen-dependent co2 reductase. (see paper)
39% identity, 59% coverage: 267:844/983 of query aligns to 1:571/571 of 7qv7S
7bkbD Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) (see paper)
38% identity, 56% coverage: 270:820/983 of query aligns to 7:538/549 of 7bkbD
2jiqA A new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand (see paper)
30% identity, 69% coverage: 265:947/983 of query aligns to 1:717/720 of 2jiqA
- active site: K46 (= K311), S106 (= S371), C137 (= C402), M138 (≠ H403), A177 (≠ G442), M305 (≠ L567), T341 (≠ R603), G342 (= G604), Q343 (= Q605)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R11 (≠ A275), Q108 (≠ R373), C137 (= C402), G171 (= G436), S172 (≠ A437), E176 (≠ D441), A177 (≠ G442), D201 (= D464), P202 (= P465), R203 (= R466), P219 (= P486), D222 (≠ N489), C304 (≠ G566), M305 (≠ L567), G306 (= G568), Q309 (≠ E571), R310 (≠ H572), G342 (= G604), Q343 (= Q605), Q343 (= Q605), E413 (≠ G671), T414 (≠ E672), N415 (≠ D673), T419 (≠ S677), I440 (≠ Q697), E441 (≠ D698), F443 (= F700), P458 (≠ G714), F460 (≠ T716), S612 (≠ T843), M613 (≠ G844), R614 (= R845), R614 (= R845), I616 (≠ L847), H618 (≠ Q849), W619 (≠ Y850), H620 (≠ N851), H620 (≠ N851), T621 (≠ V852), T623 (≠ A854), F686 (= F916), N694 (= N924), Y710 (= Y940), K711 (= K941)
- binding nitrate ion: M251 (vs. gap), K583 (≠ R816), V589 (= V822), W591 (≠ T824), R593 (≠ F826), V704 (≠ A934)
- binding iron/sulfur cluster: C10 (= C274), C13 (= C277), T15 (≠ V279), C17 (= C281), L43 (≠ A308), C44 (= C309), V180 (= V445)
2jirA A new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand (see paper)
30% identity, 69% coverage: 265:947/983 of query aligns to 1:717/720 of 2jirA
- active site: K46 (= K311), S106 (= S371), C137 (= C402), M138 (≠ H403), A177 (≠ G442), M305 (≠ L567), T341 (≠ R603), G342 (= G604), Q343 (= Q605)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R11 (≠ A275), K46 (= K311), Q108 (≠ R373), C137 (= C402), G171 (= G436), S172 (≠ A437), N173 (= N438), E176 (≠ D441), A177 (≠ G442), D201 (= D464), P202 (= P465), R203 (= R466), F217 (≠ L484), D222 (≠ N489), C304 (≠ G566), M305 (≠ L567), G306 (= G568), Q309 (≠ E571), R310 (≠ H572), G342 (= G604), Q343 (= Q605), Q343 (= Q605), E413 (≠ G671), T414 (≠ E672), N415 (≠ D673), T419 (≠ S677), I440 (≠ Q697), E441 (≠ D698), A442 (≠ I699), P458 (≠ G714), F460 (≠ T716), S612 (≠ T843), M613 (≠ G844), R614 (= R845), R614 (= R845), I616 (≠ L847), H618 (≠ Q849), W619 (≠ Y850), H620 (≠ N851), H620 (≠ N851), T621 (≠ V852), T623 (≠ A854), F686 (= F916), N694 (= N924), Y710 (= Y940), K711 (= K941)
- binding nitrite ion: V615 (≠ I846), F686 (= F916)
- binding iron/sulfur cluster: C10 (= C274), C13 (= C277), T15 (≠ V279), C17 (= C281), L43 (≠ A308), C44 (= C309), P179 (= P444), V180 (= V445)
2v45A A new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand (see paper)
30% identity, 69% coverage: 265:947/983 of query aligns to 4:720/723 of 2v45A
- active site: K49 (= K311), S109 (= S371), C140 (= C402), M141 (≠ H403), A180 (≠ G442), M308 (≠ L567), T344 (≠ R603), G345 (= G604), Q346 (= Q605)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R14 (≠ A275), K49 (= K311), Q111 (≠ R373), C140 (= C402), G174 (= G436), N176 (= N438), E179 (≠ D441), A180 (≠ G442), D204 (= D464), P205 (= P465), R206 (= R466), P222 (= P486), D225 (≠ N489), C307 (≠ G566), M308 (≠ L567), G309 (= G568), Q312 (≠ E571), R313 (≠ H572), G345 (= G604), Q346 (= Q605), Q346 (= Q605), E416 (≠ G671), T417 (≠ E672), N418 (≠ D673), T422 (≠ S677), I443 (≠ Q697), E444 (≠ D698), A445 (≠ I699), F446 (= F700), P461 (≠ G714), F463 (≠ T716), S615 (≠ T843), M616 (≠ G844), R617 (= R845), R617 (= R845), V618 (≠ I846), I619 (≠ L847), H621 (≠ Q849), W622 (≠ Y850), H623 (≠ N851), H623 (≠ N851), T624 (≠ V852), T626 (≠ A854), F689 (= F916), N697 (= N924), Y713 (= Y940), K714 (= K941)
- binding iron/sulfur cluster: C13 (= C274), C16 (= C277), T18 (≠ V279), C20 (= C281), L46 (≠ A308), C47 (= C309), V183 (= V445)
P81186 Periplasmic nitrate reductase; EC 1.9.6.1 from Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB) (see 3 papers)
29% identity, 69% coverage: 265:947/983 of query aligns to 36:752/755 of P81186
Sites not aligning to the query:
- 1:32 signal peptide, Tat-type signal
7t30A Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/NAD(h) bound state (see paper)
26% identity, 70% coverage: 49:740/983 of query aligns to 3:618/666 of 7t30A
- binding fe2/s2 (inorganic) cluster: C36 (= C82), G45 (= G91), C47 (= C93), R48 (= R94), C50 (= C96), C64 (= C110)
- binding iron/sulfur cluster: F93 (≠ I139), H98 (≠ L144), F99 (≠ D145), C100 (= C146), C103 (= C149), Q105 (≠ A151), C109 (= C155), L141 (≠ F190), R147 (≠ K196), C148 (= C197), L150 (≠ V199), C151 (= C200), Q152 (≠ N201), C154 (= C203), C158 (= C207), C192 (= C240), V193 (= V241), N194 (≠ S242), C195 (= C243), G196 (= G244), A197 (= A245), C198 (= C246), C202 (= C250), P203 (= P251), T204 (= T252), G205 (≠ A253), T206 (= T254), I207 (≠ L255), C229 (= C274), C232 (= C277), G235 (= G280), C236 (= C281), L263 (≠ A308), C264 (= C309), V396 (= V445)
8oh5C Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
26% identity, 66% coverage: 185:836/983 of query aligns to 601:1156/1172 of 8oh5C
- binding iron/sulfur cluster: C613 (= C197), V614 (≠ I198), L615 (≠ V199), C616 (= C200), G617 (≠ N201), C619 (= C203), C623 (= C207), I643 (≠ V227), C656 (= C240), I657 (≠ V241), S658 (= S242), C659 (= C243), G660 (= G244), C662 (= C246), C666 (= C250), G669 (≠ A253), A670 (≠ T254), C692 (= C274), Y694 (= Y276), C695 (= C277), C699 (= C281), C725 (= C309), R727 (≠ K311), G728 (= G312), V853 (= V445)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 199, 201, 202, 203, 222, 223, 229, 230, 235, 239, 264, 265, 285, 288, 332, 471, 477, 479
- binding fe2/s2 (inorganic) cluster: 36, 45, 47, 48, 50, 64
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 330, 331, 332, 333, 353, 354, 355, 432, 433, 434, 477
- binding iron/sulfur cluster: 96, 98, 100, 102, 104, 108, 147, 149, 151, 155, 156, 164, 170, 480, 562, 563, 565, 567, 573
8e9hG Mycobacterial respiratory complex i, fully-inserted quinone (see paper)
32% identity, 42% coverage: 50:465/983 of query aligns to 5:413/782 of 8e9hG
- binding fe2/s2 (inorganic) cluster: R35 (≠ K80), C37 (= C82), D38 (≠ A83), G46 (= G91), C48 (= C93), R49 (= R94), C51 (= C96), A63 (= A108), C65 (= C110)
- binding guanosine-5'-triphosphate: R320 (= R373)
- binding iron/sulfur cluster: H99 (= H142), D102 (= D145), C103 (= C146), C106 (= C149), G109 (≠ N152), C112 (= C155), Q115 (= Q158), C152 (= C197), V153 (≠ I198), L154 (≠ V199), C155 (= C200), A156 (≠ N201), R157 (= R202), C158 (= C203), C202 (= C250), P203 (= P251), V204 (≠ T252), A206 (≠ T254), L207 (= L255), C228 (= C274), C231 (= C277), S233 (≠ V279), C235 (= C281), N262 (≠ A308), C263 (= C309), G266 (= G312), P391 (= P444), I392 (≠ V445)
Sites not aligning to the query:
- binding guanosine-5'-triphosphate: 486, 487, 554, 556, 559, 579, 580, 582, 627, 689, 695, 696, 697
Q53176 Periplasmic nitrate reductase; EC 1.9.6.1 from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
24% identity, 69% coverage: 274:950/983 of query aligns to 48:831/831 of Q53176
- C48 (= C274) binding
- C51 (= C277) binding
- C55 (= C281) binding
- C83 (= C309) binding
- K85 (= K311) binding
- Q152 (≠ R373) binding
- N177 (≠ C398) binding
- C181 (= C402) binding
- 214:221 (vs. 435:442, 25% identical) binding
- GTD 264:266 (≠ GTN 487:489) binding
- M375 (≠ L567) binding
- Q379 (≠ E571) binding
- N485 (≠ D673) binding
- SD 511:512 (≠ QD 697:698) binding
- K534 (= K720) binding
- D561 (≠ E748) binding
- 721:730 (vs. 843:852, 40% identical) binding
- N805 (= N924) binding
- K822 (= K941) binding
8a6tA Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
43% identity, 21% coverage: 50:259/983 of query aligns to 4:208/571 of 8a6tA
- binding fe2/s2 (inorganic) cluster: C36 (= C82), D37 (≠ A83), C47 (= C93), R48 (= R94), C50 (= C96), C63 (= C110)
- binding iron/sulfur cluster: H95 (= H142), C99 (= C146), C102 (= C149), C108 (= C155), C146 (= C197), C149 (= C200), G150 (≠ N201), K151 (≠ R202), C152 (= C203), C156 (= C207), C189 (= C240), C192 (= C243), C195 (= C246), C199 (= C250), G202 (≠ A253)
Sites not aligning to the query:
- binding 2 iron/2 sulfur/5 carbonyl/2 water inorganic cluster: 229, 230, 231, 298, 323, 352, 353, 357, 412, 500
- binding iron/sulfur cluster: 299, 354, 496, 500
1ogyC Crystal structure of the heterodimeric nitrate reductase from rhodobacter sphaeroides (see paper)
24% identity, 69% coverage: 274:947/983 of query aligns to 8:788/789 of 1ogyC
- active site: N42 (≠ A308), C43 (= C309), K45 (= K311), G111 (≠ S372), W113 (≠ C374), C141 (= C402), M142 (≠ H403), M335 (≠ L567), T371 (≠ R603), G372 (= G604), Q373 (= Q605)
- binding heme c: L41 (≠ H307), N42 (≠ A308), Y47 (≠ R313)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R9 (≠ A275), K45 (= K311), Q112 (≠ R373), N137 (≠ C398), H140 (≠ V401), C141 (= C402), G175 (= G436), N177 (= N438), E180 (≠ D441), M181 (≠ G442), S205 (≠ D464), T206 (≠ P465), H209 (vs. gap), F221 (≠ L484), G224 (= G487), D226 (≠ N489), T334 (≠ G566), M335 (≠ L567), M335 (≠ L567), G336 (= G568), F337 (≠ V569), Q339 (≠ E571), G372 (= G604), Q373 (= Q605), Q373 (= Q605), V443 (≠ G671), N444 (≠ E672), N445 (≠ D673), A449 (≠ S677), S471 (≠ Q697), D472 (= D698), A488 (≠ G714), M490 (≠ T716), D521 (≠ E748), T681 (= T843), G682 (= G844), R683 (= R845), R683 (= R845), V684 (≠ I846), L685 (= L847), H687 (≠ Q849), W688 (≠ Y850), W688 (≠ Y850), H689 (≠ N851), H689 (≠ N851), S690 (≠ V852), S692 (≠ A854), W757 (≠ F916), N765 (= N924), F781 (≠ Y940), K782 (= K941), K783 (≠ V942)
- binding molybdenum atom: C141 (= C402), Q373 (= Q605)
- binding iron/sulfur cluster: C8 (= C274), C11 (= C277), C15 (= C281), N42 (≠ A308), C43 (= C309), I184 (≠ V445)
1ogyA Crystal structure of the heterodimeric nitrate reductase from rhodobacter sphaeroides (see paper)
24% identity, 69% coverage: 274:947/983 of query aligns to 8:788/789 of 1ogyA
- active site: N42 (≠ A308), C43 (= C309), K45 (= K311), G111 (≠ S372), W113 (≠ C374), C141 (= C402), M142 (≠ H403), M335 (≠ L567), T371 (≠ R603), G372 (= G604), Q373 (= Q605)
- binding heme c: L41 (≠ H307), N42 (≠ A308), Y47 (≠ R313)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R9 (≠ A275), K45 (= K311), Q112 (≠ R373), N137 (≠ C398), C141 (= C402), G175 (= G436), N177 (= N438), M181 (≠ G442), S205 (≠ D464), T206 (≠ P465), H209 (vs. gap), F221 (≠ L484), G224 (= G487), D226 (≠ N489), T334 (≠ G566), M335 (≠ L567), G336 (= G568), F337 (≠ V569), Q339 (≠ E571), G372 (= G604), Q373 (= Q605), Q373 (= Q605), V443 (≠ G671), N444 (≠ E672), N445 (≠ D673), A449 (≠ S677), S471 (≠ Q697), D472 (= D698), A488 (≠ G714), M490 (≠ T716), D521 (≠ E748), T681 (= T843), R683 (= R845), R683 (= R845), V684 (≠ I846), L685 (= L847), H687 (≠ Q849), W688 (≠ Y850), W688 (≠ Y850), H689 (≠ N851), H689 (≠ N851), S690 (≠ V852), S692 (≠ A854), W757 (≠ F916), N765 (= N924), F781 (≠ Y940), K782 (= K941), K783 (≠ V942)
- binding iron/sulfur cluster: C8 (= C274), C11 (= C277), C15 (= C281), N42 (≠ A308), C43 (= C309), I184 (≠ V445)
7arcG Cryo-em structure of polytomella complex-i (peripheral arm) (see paper)
30% identity, 45% coverage: 54:497/983 of query aligns to 10:426/682 of 7arcG
- binding fe2/s2 (inorganic) cluster: R36 (≠ K80), C38 (= C82), Y39 (≠ A83), G47 (= G91), C49 (= C93), R50 (= R94), C52 (= C96), C66 (= C110)
- binding iron/sulfur cluster: H98 (= H142), D101 (= D145), C102 (= C146), C105 (= C149), Q107 (≠ A151), C111 (= C155), Q114 (= Q158), C150 (= C197), I151 (= I198), C153 (= C200), C156 (= C203), C200 (= C250), V202 (≠ T252), A204 (≠ T254), L205 (= L255)
- binding : K272 (≠ H321), Q274 (≠ D323), R275 (= R324), N277 (≠ T326)
Sites not aligning to the query:
7b0nG 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
29% identity, 44% coverage: 49:480/983 of query aligns to 2:425/694 of 7b0nG
- binding fe2/s2 (inorganic) cluster: C35 (= C82), G44 (= G91), C46 (= C93), R47 (= R94), C49 (= C96), C63 (= C110)
- binding iron/sulfur cluster: H95 (= H142), C99 (= C146), C102 (= C149), C108 (= C155), Q111 (= Q158), C149 (= C197), H151 (≠ V199), C152 (= C200), T153 (≠ N201), C155 (= C203), C199 (= C250), V201 (≠ T252)
Query Sequence
>H281DRAFT_03942 FitnessBrowser__Burk376:H281DRAFT_03942
MSDMLNTPAGGCGSGNCACKSQAQAQSRTPRSYFDDTDYGTPERHADIDVTLEIDGQAVT
VPAGTSVMRAAIEAGVNVPKLCATDSLEPFGSCRLCLVEIEGKRGYPASCTTPVEAGMKV
RTQSDRLQSLRRNVMELYISDHPLDCLTCPANGDCELQDMAGVTGLREVRYGIDGANHLQ
DKKDESNPYFTYDPAKCIVCNRCVRACEETQGTFALTIAGRGFESRVAASENQPFMESEC
VSCGACVSACPTATLQEKTVVMLGQAEHSVVTTCAYCGVGCSFKAEMKGNQVVRMVPFKN
GQANEGHACVKGRFAWGYATHKDRITKPMIRAKITDPWREVSWEEAINYAASEFRRIQAK
HGRDSIGGITSSRCTNEETYLVQKLVRAAFGNNNVDTCARVCHSPTGYGLKTTLGESAGT
QTFASVDKADVIMVIGANPTDGHPVFGSRLKRRVREGAKLIVVDPRRIDIVDTPHVKASH
HLQLRPGTNVAIVNALAHVIVTEGLLNEAFISERCEGRAFDQWRDFVALPENAPEATEAV
TGVPAKDVREAARIYATGGNAAIYYGLGVTEHAQGSTMVMGIANLAMATGNIGREGVGVN
PLRGQNNVQGSCDMGSFPHELPGYRHISDTIVRSQFEDAWNVTLQTEPGLRIPNMFEAAL
DGSFMGLYCQGEDIVQSDPNTHHVAAALSSMECIVVQDIFLNETAKYAHVLLPGSTFLEK
DGTFTNAERRISRVRKVMPPVPGYADWEVTLLLSRALGYEMDYAHPSEIMDEIARLTPTF
HGVSYKKIDELGSIQWPCNEEAPDGTPTMHIDTFVRGKGKFVITKFIASPEKVTRKFPLL
LTTGRILSQYNVGAQTRRTENSRWHDEDRLELHPHDAEERGIKTGDWVGIESRAGQTVLR
AKVTERMQPGVVYTTFHFPESGANVITTDSSDWATNCPEYKVTAVQVMPVEQPSQWQKEY
SRFNAEQLELLKQREMANATAGK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory