Comparing H281DRAFT_03954 FitnessBrowser__Burk376:H281DRAFT_03954 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
3fijA Crystal structure of a uncharacterized protein lin1909
42% identity, 34% coverage: 306:473/493 of query aligns to 42:208/224 of 3fijA
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
39% identity, 32% coverage: 306:465/493 of query aligns to 124:279/308 of O33341
Sites not aligning to the query:
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
41% identity, 34% coverage: 306:475/493 of query aligns to 64:238/255 of 7d50B
7d53A Spua mutant - h221n with glu (see paper)
41% identity, 34% coverage: 306:475/493 of query aligns to 58:232/249 of 7d53A
6vtvB Crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. Coli
30% identity, 43% coverage: 257:467/493 of query aligns to 17:224/252 of 6vtvB
P76038 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD; Gamma-Glu-GABA hydrolase; EC 3.5.1.94 from Escherichia coli (strain K12) (see paper)
30% identity, 43% coverage: 257:467/493 of query aligns to 19:226/254 of P76038
7d4rB Spua native structure (see paper)
43% identity, 26% coverage: 349:475/493 of query aligns to 70:200/215 of 7d4rB
>H281DRAFT_03954 FitnessBrowser__Burk376:H281DRAFT_03954
MSENKPENAGQPGSATPPAASPESFSQTPAEPTTSLPLSHEDAIQSPVKDPVASKAAPSS
VPVTASVSAPATSSEAAARSSTDDPESASTVTPVVKRTAQQRDAAEARSSAAASTAKQEA
AVHERDSRPVRGREVPSTHSATPLTSEPIQGELITSADDVLAAEDAAASAARPAGSPPGF
GAAPDFTATNPPPPNALPPSPPRYLKQTDSAWSVFGRIIAARARQLFDRAGQRITQRTLR
IGVSARIFHPEPGAKGLRGKTLQYLEESIAHWVMSRDVLVFMIPTVGHQGMLHPSNIRLR
DYAKHLDGLLLQGGADVSPQSYAEAATSPEWPGDRVRDMYELELLHEFIESGKPVLGVCR
GCQLINVAFGGTLYQDIATDVPTAGAHVNEDYDQHRHAIHFPDGSTLANMFPARRDAIVN
SIHHQAVKTLGRDLNIEAVSASDGIIEAVRYRRAPFVMGVQWHPEFHRAGGPELLDCTPL
LDTFLRVARETRF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory