Comparing H281DRAFT_04049 FitnessBrowser__Burk376:H281DRAFT_04049 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
36% identity, 42% coverage: 20:285/640 of query aligns to 3:267/330 of P0AAH4
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
36% identity, 43% coverage: 20:292/640 of query aligns to 4:270/326 of Q8RDH4
Sites not aligning to the query:
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
37% identity, 41% coverage: 20:280/640 of query aligns to 3:257/310 of 4fwiB
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 46% coverage: 347:639/640 of query aligns to 8:299/343 of P30750
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
35% identity, 43% coverage: 347:624/640 of query aligns to 9:285/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
35% identity, 43% coverage: 347:624/640 of query aligns to 9:285/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
35% identity, 43% coverage: 347:624/640 of query aligns to 9:285/344 of 6cvlD
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
37% identity, 35% coverage: 363:587/640 of query aligns to 22:247/253 of 7z15I
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
37% identity, 35% coverage: 363:587/640 of query aligns to 22:247/250 of 7z18I
Sites not aligning to the query:
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
36% identity, 35% coverage: 363:587/640 of query aligns to 22:247/250 of 7z16I
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
35% identity, 40% coverage: 332:587/640 of query aligns to 1:239/241 of 4u00A
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
34% identity, 37% coverage: 355:589/640 of query aligns to 17:248/375 of 2d62A
1g291 Malk (see paper)
34% identity, 37% coverage: 352:589/640 of query aligns to 11:245/372 of 1g291
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
35% identity, 36% coverage: 355:587/640 of query aligns to 14:241/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
35% identity, 36% coverage: 355:587/640 of query aligns to 14:241/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
35% identity, 36% coverage: 355:587/640 of query aligns to 14:241/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
35% identity, 36% coverage: 355:587/640 of query aligns to 14:241/242 of 2oljA
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
32% identity, 36% coverage: 354:581/640 of query aligns to 36:260/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
32% identity, 36% coverage: 354:581/640 of query aligns to 36:260/382 of 7aheC
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 35% coverage: 362:587/640 of query aligns to 35:251/378 of P69874
Sites not aligning to the query:
>H281DRAFT_04049 FitnessBrowser__Burk376:H281DRAFT_04049
VPTSSHTASPITGNLPTQRVLAVDNLSVAFRSGETTFNAVRNLSLMVERGETLAIVGESG
SGKSVTSLALMRLIEHGGGRLAGGSIAFRRRDGSVLDLAKASSGTMRSIRGADIAMIFQE
PMTSLNPVFTVGDQISEAISLHQGKSRSAAFAETLRLLELVRIPEARRVAARFPHQLSGG
MRQRVMIAMALSCKPALLIADEPTTALDVTIQAQILQLIRGLQDEMNMGVIFITHDMGVV
AEVADRVLVMYRGEKVEEGASDALFAAPSHPYTKALLAAVPRLGAMQGTDQPAKFPILTV
EQAGASGADEPVRPAAAVAKEAQPHVDESTPPILRVRDLVTRFPVRTGLFGRLTGRVHAV
EKVSFDLRPGETLALVGESGCGKSTTGRSLLRLVESQSGSIEFDGKEISSLTGPALQALR
RDIQFIFQDPFASLNPRLTVGFSIMEPLLVHGVAQGAEAQARVAWLLEKVGLPPEAARRY
PHEFSGGQRQRIAIARALALNPKVVIADESVSALDVSVQAQIVNLMLDLQRELGVAYLFI
SHDMAVVERVSHRVAVMYLGQIVEIGPRRAVFEAPQHPYTRKLMGAVPVADPARRHAKRM
LAADEIPSPIRSLNDEPAVAPLVAVGPGHFVAQHRVGGAY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory