Comparing H281DRAFT_04050 FitnessBrowser__Burk376:H281DRAFT_04050 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P37595 Isoaspartyl peptidase; Beta-aspartyl-peptidase; EcAIII; Isoaspartyl dipeptidase; EC 3.4.19.5 from Escherichia coli (strain K12) (see 2 papers)
58% identity, 99% coverage: 4:331/331 of query aligns to 3:312/321 of P37595
1jn9A Structure of putative asparaginase encoded by escherichia coli ybik gene (see paper)
59% identity, 47% coverage: 4:160/331 of query aligns to 2:158/158 of 1jn9A
8c0iAAA Isoaspartyl peptidase subunit alpha (see paper)
60% identity, 47% coverage: 4:158/331 of query aligns to 2:156/156 of 8c0iAAA
2zalB Crystal structure of e. Coli isoaspartyl aminopeptidase/l-asparaginase in complex with l-aspartate (see paper)
65% identity, 40% coverage: 198:331/331 of query aligns to 1:134/135 of 2zalB
8c23DDD Isoaspartyl peptidase subunit beta (see paper)
65% identity, 40% coverage: 198:331/331 of query aligns to 1:134/135 of 8c23DDD
Q7L266 Isoaspartyl peptidase/L-asparaginase; Asparaginase-like protein 1; Beta-aspartyl-peptidase; Isoaspartyl dipeptidase; L-asparagine amidohydrolase; EC 3.4.19.5; EC 3.5.1.1 from Homo sapiens (Human) (see 4 papers)
36% identity, 97% coverage: 4:323/331 of query aligns to 2:292/308 of Q7L266
4osxA Structure of uncleaved glycine-bound human l-asparaginase protein (see paper)
36% identity, 97% coverage: 4:323/331 of query aligns to 3:284/300 of 4osxA
4pvrA Crystal structure of partially-cleaved human l-asparaginase protein in complex with l-aspartate (see paper)
36% identity, 97% coverage: 4:323/331 of query aligns to 3:282/298 of 4pvrA
4o0hA Crystal structure of human l-asparaginase protein with covalently linked substrate l-asparagine (see paper)
35% identity, 97% coverage: 4:323/331 of query aligns to 3:279/295 of 4o0hA
4o48A Crystal structure of cleaved guinea pig l-asparaginase type iii in complex with l-aspartate (see paper)
36% identity, 93% coverage: 6:314/331 of query aligns to 5:273/298 of 4o48A
2gezB Crystal structure of potassium-independent plant asparaginase (see paper)
57% identity, 39% coverage: 198:327/331 of query aligns to 1:133/133 of 2gezB
1p4vA Crystal structure of the glycosylasparaginase precursor d151n mutant with glycine (see paper)
31% identity, 87% coverage: 29:315/331 of query aligns to 11:266/295 of 1p4vA
Q47898 N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; AGA; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Elizabethkingia miricola (Chryseobacterium miricola) (see 5 papers)
31% identity, 87% coverage: 29:315/331 of query aligns to 56:311/340 of Q47898
Sites not aligning to the query:
4r4yA Structural basis of a point mutation that causes the genetic disease aspartylglucosaminuria (see paper)
31% identity, 87% coverage: 29:315/331 of query aligns to 9:264/293 of 4r4yA
P20933 N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Homo sapiens (Human) (see 11 papers)
36% identity, 69% coverage: 39:268/331 of query aligns to 42:276/346 of P20933
Sites not aligning to the query:
4pu6B Crystal structure of potassium-dependent plant-type l-asparaginase from phaseolus vulgaris in complex with k+ cations (see paper)
52% identity, 37% coverage: 198:319/331 of query aligns to 1:119/131 of 4pu6B
Q9H6P5 Threonine aspartase 1; Taspase-1; EC 3.4.25.- from Homo sapiens (Human) (see 2 papers)
32% identity, 78% coverage: 7:265/331 of query aligns to 44:307/420 of Q9H6P5
4pv2C Crystal structure of potassium-dependent plant-type l-asparaginase from phaseolus vulgaris in complex with k+ and na+ cations (see paper)
40% identity, 46% coverage: 7:159/331 of query aligns to 5:155/158 of 4pv2C
2gezC Crystal structure of potassium-independent plant asparaginase (see paper)
37% identity, 49% coverage: 7:167/331 of query aligns to 5:164/166 of 2gezC
P30919 N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; AGA; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Rattus norvegicus (Rat) (see paper)
34% identity, 69% coverage: 39:268/331 of query aligns to 42:275/345 of P30919
Sites not aligning to the query:
>H281DRAFT_04050 FitnessBrowser__Burk376:H281DRAFT_04050
MNDNAVIAIHGGAGTILRASLSASAEAEYHAALHAVLAAGQRVLADGGSALDAVSEAVRL
LEDCPLFNAGRGAVYTAAGTHELDAAIMDGSTLEAGAICCVKRVRNPVLAARRVLECSEH
VLFAGEGAESFAAAQGLEFVEPQYFDTEARLRQWLLARDQQRAMLDHDGASLAASPSATD
NSDPVPHEPIDPNRKFGTVGAVALDRHGHVAAATSTGGVTNKQVGRVGDTPLIGAGCYAD
DATCAVSTTGSGEMFMRMVAAYDVAAQMAYRNVSLQEAAHDVVMNRLPKIDGRGGLIAVD
ALGNIALPFNTEGMYRGFARIGEAPTTAIYR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory