SitesBLAST
Comparing H281DRAFT_04096 FitnessBrowser__Burk376:H281DRAFT_04096 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5c7hA Crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 in complex with NADPH
54% identity, 100% coverage: 1:281/281 of query aligns to 1:281/281 of 5c7hA
- active site: D52 (= D52), Y57 (= Y57), K82 (= K82), H115 (= H115)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G22 (= G22), T23 (= T23), W24 (= W24), D52 (= D52), Y57 (= Y57), H115 (= H115), Q167 (= Q167), Y195 (= Y195), S196 (= S196), P197 (= P197), L198 (≠ V198), E200 (≠ H200), L204 (≠ P204), A221 (≠ F221), I237 (= I237), P238 (= P238), K239 (= K239), T240 (= T240), R245 (≠ H245), E248 (≠ D248), N249 (= N249), I281 (≠ L281)
4pmjA Crystal structure of a putative oxidoreductase from sinorhizobium meliloti 1021 in complex with NADP
54% identity, 100% coverage: 1:281/281 of query aligns to 1:281/281 of 4pmjA
- active site: D52 (= D52), Y57 (= Y57), K82 (= K82), H115 (= H115)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G22 (= G22), T23 (= T23), W24 (= W24), D52 (= D52), H115 (= H115), Q167 (= Q167), Y195 (= Y195), S196 (= S196), P197 (= P197), L198 (≠ V198), E200 (≠ H200), L204 (≠ P204), A221 (≠ F221), I237 (= I237), P238 (= P238), K239 (= K239), T240 (= T240), G241 (= G241), R245 (≠ H245), E248 (≠ D248), N249 (= N249)
4wghA Crystal structure of aldo/keto reductase from klebsiella pneumoniae in complex with NADP and acetate at 1.8 a resolution
50% identity, 98% coverage: 7:281/281 of query aligns to 4:283/283 of 4wghA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G22), T20 (= T23), W21 (= W24), D49 (= D52), Y54 (= Y57), N142 (= N145), Q164 (= Q167), Y192 (= Y195), C193 (≠ S196), P194 (= P197), L195 (≠ V198), Q197 (≠ H200), A198 (= A201), R200 (vs. gap), A223 (≠ F221), I239 (= I237), P240 (= P238), K241 (= K239), A242 (≠ T240), A243 (≠ G241), S244 (≠ R242), H247 (= H245), N251 (= N249)
6ciaA Crystal structure of aldo-keto reductase from klebsiella pneumoniae in complex with NADPH.
50% identity, 98% coverage: 7:281/281 of query aligns to 5:284/284 of 6ciaA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G22), T21 (= T23), W22 (= W24), D50 (= D52), Y55 (= Y57), H113 (= H115), N143 (= N145), Q165 (= Q167), Y193 (= Y195), C194 (≠ S196), P195 (= P197), L196 (≠ V198), Q198 (≠ H200), A199 (= A201), A224 (≠ F221), I240 (= I237), P241 (= P238), K242 (= K239), A243 (≠ T240), A244 (≠ G241), S245 (≠ R242), H248 (= H245), N252 (= N249)
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
41% identity, 91% coverage: 13:267/281 of query aligns to 11:273/275 of 6kiyA
- binding {5-[(2E)-2-methyl-3-phenylprop-2-en-1-ylidene]-4-oxo-2-thioxo-1,3-thiazolidin-3-yl}acetic acid: W22 (= W24), Y59 (= Y57), W87 (≠ Y84), H118 (= H115), R204 (≠ H200)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G22), T21 (= T23), W22 (= W24), Y59 (= Y57), H118 (= H115), N149 (= N145), Q170 (= Q167), Y199 (= Y195), S200 (= S196), P201 (= P197), L202 (≠ V198), R204 (≠ H200), T205 (≠ A201), Y227 (≠ F221), I243 (= I237), P244 (= P238), K245 (= K239), G247 (= G241), R248 (= R242), H251 (= H245), E254 (≠ D248), N255 (= N249)
6kikA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor tolrestat (see paper)
41% identity, 91% coverage: 13:267/281 of query aligns to 11:273/275 of 6kikA
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
41% identity, 91% coverage: 13:267/281 of query aligns to 10:272/274 of 5danA
- active site: D53 (= D52), Y58 (= Y57), K84 (= K82), H117 (= H115)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G22), T20 (= T23), W21 (= W24), D53 (= D52), Y58 (= Y57), H117 (= H115), Q169 (= Q167), Y198 (= Y195), S199 (= S196), P200 (= P197), L201 (≠ V198), R203 (≠ H200), Y226 (≠ F221), I242 (= I237), P243 (= P238), K244 (= K239), G246 (= G241), R247 (= R242), H250 (= H245), E253 (≠ D248), N254 (= N249)
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
33% identity, 77% coverage: 18:233/281 of query aligns to 15:273/331 of P80874
- TW 20:21 (= TW 23:24) binding
- D52 (= D52) binding
- Q175 (= Q167) binding
- YGSLCR 203:208 (≠ Y----- 195) binding
- K214 (vs. gap) binding
- R227 (vs. gap) binding
Sites not aligning to the query:
- 280:282 binding
- 286 binding
Q9GV41 9,11-endoperoxide prostaglandin H2 reductase; Prostaglandin F2-alpha synthase; EC 1.1.1.- from Trypanosoma brucei brucei
30% identity, 93% coverage: 7:266/281 of query aligns to 6:257/276 of Q9GV41
1vbjA The crystal structure of prostaglandin f synthase from trypanosoma brucei
30% identity, 93% coverage: 7:266/281 of query aligns to 11:262/281 of 1vbjA
- active site: D52 (= D52), Y57 (= Y57), K82 (= K82), H115 (= H115)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G26 (= G22), M27 (≠ T23), W28 (= W24), D52 (= D52), Y57 (= Y57), H115 (= H115), N145 (= N145), Q166 (= Q167), W192 (≠ Y195), S193 (= S196), P194 (= P197), L195 (≠ V198), Q197 (≠ H200), G198 (≠ A201), V201 (≠ P204), A218 (≠ F221), I233 (= I237), K235 (= K239), S236 (≠ T240), G237 (= G241), R241 (≠ H245), E244 (≠ D248), N245 (= N249)
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
32% identity, 77% coverage: 18:233/281 of query aligns to 15:273/333 of 1pz1A
- active site: D52 (= D52), Y57 (= Y57), K90 (≠ P85), Q93 (vs. gap), H125 (= H115)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G22), W21 (= W24), Q175 (= Q167), Y203 (= Y195), G204 (vs. gap), L206 (vs. gap), R208 (vs. gap), K214 (vs. gap)
Sites not aligning to the query:
A0QV10 Aldo-keto reductase MSMEG_2408/MSMEI_2347; EC 1.1.1.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
30% identity, 93% coverage: 8:267/281 of query aligns to 5:257/275 of A0QV10
Sites not aligning to the query:
- 262 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
4gieA Crystal structure of prostaglandin f synthase from trypanosoma cruzi bound to NADP (see paper)
29% identity, 95% coverage: 1:266/281 of query aligns to 8:268/288 of 4gieA
- active site: D55 (= D52), Y60 (= Y57), K85 (= K82), H118 (= H115)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G29 (= G22), W31 (= W24), D55 (= D52), Y60 (= Y57), H118 (= H115), W119 (= W116), N148 (= N145), Q169 (≠ V172), W195 (≠ Y195), S196 (= S196), P197 (= P197), L198 (≠ V198), S200 (vs. gap), L207 (≠ P204), A224 (≠ F221), I239 (= I237), P240 (= P238), K241 (= K239), S242 (≠ T240), R247 (≠ H245), E250 (≠ D248), N251 (= N249)
4fziA Crystal structure of prostaglandin f synthase from trypanosoma cruzi (see paper)
29% identity, 93% coverage: 7:266/281 of query aligns to 3:257/277 of 4fziA
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
32% identity, 82% coverage: 37:266/281 of query aligns to 30:289/301 of 6ow0B
Sites not aligning to the query:
4g5dA X-ray crystal structure of prostaglandin f synthase from leishmania major friedlin bound to NADPH (see paper)
28% identity, 94% coverage: 3:267/281 of query aligns to 3:267/283 of 4g5dA
- active site: D48 (= D52), Y53 (= Y57), K78 (= K82), H111 (= H115)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G22 (= G22), V23 (≠ T23), W24 (= W24), D48 (= D52), Y53 (= Y57), H111 (= H115), S148 (= S144), N149 (= N145), Q170 (≠ D166), W196 (≠ Y195), S197 (= S196), P198 (= P197), L199 (≠ V198), Q201 (≠ H200), G202 (≠ A201), L205 (≠ P204), I237 (= I237), P238 (= P238), K239 (= K239), S240 (≠ T240), V241 (≠ G241), H242 (≠ R242), R245 (≠ H245), E248 (≠ D248), N249 (= N249)
5az1A Crystal structure of aldo-keto reductase (akr2e5) complexed with nadph (see paper)
28% identity, 98% coverage: 3:278/281 of query aligns to 2:299/327 of 5az1A
- active site: D53 (= D52), Y58 (= Y57), K87 (= K82), H120 (= H115)
- binding calcium ion: R79 (= R74), L111 (≠ T106), D112 (= D107), H113 (≠ R108)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G21 (= G22), T22 (= T23), W23 (= W24), D53 (= D52), Y58 (= Y57), H120 (= H115), Q180 (= Q167), Y206 (= Y195), S207 (= S196), P208 (= P197), F209 (≠ V198), V213 (≠ L203), S215 (≠ K205), R216 (= R206), T243 (≠ F221), I258 (= I237), P259 (= P238), K260 (= K239), T261 (= T240), V262 (≠ G241), T263 (≠ R242), R266 (≠ H245), E269 (≠ D248), N270 (= N249)
2wzmA Crystal structure of a mycobacterium aldo-keto reductase in its apo and liganded form (see paper)
29% identity, 93% coverage: 5:266/281 of query aligns to 2:256/274 of 2wzmA
- active site: D44 (= D52), Y49 (= Y57), K74 (= K82), H107 (= H115)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: Y186 (= Y195), G187 (≠ S196), P188 (= P197), L189 (≠ V198), G190 (≠ D199), V191 (≠ H200), G192 (≠ A201), L195 (≠ P204), A212 (≠ F221), I227 (= I237), R229 (≠ K239), S230 (≠ T240), R235 (≠ H245), N239 (= N249)
Sites not aligning to the query:
A0QV09 Aldo-keto reductase MSMEG_2407/MSMEI_2346; AKR; AKR5H1; EC 1.1.1.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
29% identity, 93% coverage: 5:266/281 of query aligns to 11:265/283 of A0QV09
- G196 (≠ S196) binding
- L198 (≠ V198) binding
- V200 (≠ H200) binding
- I236 (= I237) binding
- R238 (≠ K239) binding
- S239 (≠ T240) binding
- A240 (≠ G241) binding
- R244 (≠ H245) binding
- S247 (≠ D248) binding
- N248 (= N249) binding
Sites not aligning to the query:
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
29% identity, 81% coverage: 37:265/281 of query aligns to 37:305/337 of Q3L181
- D52 (= D52) mutation to A: 99% loss of activity.
- Y57 (= Y57) mutation to A: 99% loss of activity.
- K84 (= K82) mutation to A: Total loss of activity.
- H126 (= H115) mutation to A: 98% loss of activity.
Query Sequence
>H281DRAFT_04096 FitnessBrowser__Burk376:H281DRAFT_04096
MTTDIASVSLPDGERIPKLGQGTWEMGEQPARRAAEIAAIRLGVELGMTLVDTAEMYGDG
ATELLLGEALAGLRDQVFLVSKVYPHNASRRGVIAACEQSLKRLKTDRLDLYLLHWRGSI
PLEETVAGFEALRDAGKIRHWGVSNFDTEDMEELIATPGGTACATDQILYNVARRGPEFD
LLPWLAERNMPAMAYSPVDHARLPKRSPLDDIASARGVSVFQVALAWVLQQPGVFAIPKT
GRVEHVRDNHRALQLRLDAQELAAIDSYFKPPRGKRPLEML
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory