Comparing H281DRAFT_04146 FitnessBrowser__Burk376:H281DRAFT_04146 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
28% identity, 98% coverage: 1:504/514 of query aligns to 2:484/492 of 3ll3A
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
28% identity, 98% coverage: 1:504/514 of query aligns to 1:482/490 of 3ll3B
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
30% identity, 98% coverage: 5:508/514 of query aligns to 3:483/484 of P09099
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
30% identity, 98% coverage: 5:508/514 of query aligns to 3:475/476 of 2itmA
5ya1A Crystal structure of lsrk-hpr complex with atp (see paper)
29% identity, 95% coverage: 3:491/514 of query aligns to 4:473/478 of 5ya1A
5ya2A Crystal structure of lsrk-hpr complex with adp (see paper)
29% identity, 95% coverage: 3:491/514 of query aligns to 4:473/478 of 5ya2A
6udeB Crystal structure of glycerol kinase from elizabethkingia anophelis nuhp1 in complex with adp and glycerol
27% identity, 92% coverage: 4:474/514 of query aligns to 5:461/495 of 6udeB
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
29% identity, 89% coverage: 4:461/514 of query aligns to 1:435/485 of 6k76A
P18157 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Bacillus subtilis (strain 168) (see paper)
26% identity, 98% coverage: 3:508/514 of query aligns to 4:493/496 of P18157
1bu6Y Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
26% identity, 90% coverage: 3:463/514 of query aligns to 4:452/499 of 1bu6Y
P0A6F3 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Escherichia coli (strain K12) (see 10 papers)
26% identity, 90% coverage: 3:463/514 of query aligns to 6:454/502 of P0A6F3
Sites not aligning to the query:
1glfO Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
26% identity, 90% coverage: 3:463/514 of query aligns to 4:452/498 of 1glfO
1bo5O Crystal structure of the complex between escherichia coli glycerol kinase and the allosteric regulator fructose 1,6-bisphosphate. (see paper)
26% identity, 90% coverage: 3:463/514 of query aligns to 4:452/498 of 1bo5O
1gllO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
26% identity, 90% coverage: 3:463/514 of query aligns to 4:448/494 of 1gllO
1gljO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
26% identity, 90% coverage: 3:463/514 of query aligns to 4:448/494 of 1gljO
1bwfO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
26% identity, 90% coverage: 3:463/514 of query aligns to 4:448/494 of 1bwfO
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
26% identity, 90% coverage: 3:463/514 of query aligns to 6:453/501 of O34154
Sites not aligning to the query:
Q9NJP9 Glycerol kinase, glycosomal; GK; Glycerokinase; ATP:glycerol 3-phosphotransferase; EC 2.7.1.30 from Trypanosoma brucei brucei (see 2 papers)
28% identity, 86% coverage: 1:440/514 of query aligns to 1:441/512 of Q9NJP9
6jafA Crystal structure of trypanosoma brucei gambiense glycerol kinase complex with ppi (pyrophosphatase reaction)
28% identity, 86% coverage: 1:440/514 of query aligns to 3:443/513 of 6jafA
6j9qA Crystal structure of trypanosoma brucei gambiense glycerol kinase complex with amp-pnp.
28% identity, 86% coverage: 1:440/514 of query aligns to 3:443/513 of 6j9qA
>H281DRAFT_04146 FitnessBrowser__Burk376:H281DRAFT_04146
MDYVIGVDIGTQSTKALLVDQHGAIVAHHASSYQPDTPRPLWAEQWPAVWFKAVTECIAA
CVRKAKEAGVAANSIKAVCVSSLYGGSGIPVDSDMRPLYPCLIWMDRRATDQVEWVRNNV
DLDRLYTITGNGVDSYYGYTKMLWLRDHEPDVWAQTRYFLPPNAYVIYMLTGEIAVDHSS
AGNIGGIYDIAKRDWSDEALDMLGIPATMMPERLVESSEVVGSLLSQWTEELGLAAGTAI
VAGGVDAAVATFAAGVSRAGQHVAMIGTSMCWGYINQTVDARHGLISMPHVFNGQRDIYV
FGGAITAGASVTWYRDQFCHAEIEAARATPHGDPHRLLEDNAAKVPAGSDGVMFLPYLMG
ERSPVWDAKASGAFVGLSLFHTRAHLYRAVLEGVSFALKHNIEAGRKGAQSLEDKLVVVG
GAAHSDLWMQIIADITGYPVYTIEQEVEAAMGAALLAALGVGLVSQEAAQGGWVTLVERA
QPDAARMALYEQRFGIYTDLYPALKPVMHRLQTS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory