SitesBLAST
Comparing H281DRAFT_04147 FitnessBrowser__Burk376:H281DRAFT_04147 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q00796 Sorbitol dehydrogenase; SDH; (R,R)-butanediol dehydrogenase; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Ribitol dehydrogenase; RDH; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.4; EC 1.1.1.14; EC 1.1.1.56; EC 1.1.1.9 from Homo sapiens (Human) (see 10 papers)
31% identity, 98% coverage: 7:362/365 of query aligns to 3:349/357 of Q00796
- C45 (= C49) binding
- H70 (= H78) binding
- E71 (= E79) binding
- R110 (≠ Q121) to P: in SORDD; results in protein aggregation
- H135 (≠ P149) to R: in SORDD; results in protein aggregation
- A153 (= A167) to D: in SORDD; uncertain significance; results in protein aggregation; dbSNP:rs145813597
- I184 (≠ L198) binding
- D204 (= D218) binding
- R209 (= R223) binding
- Q239 (≠ G253) to L: in dbSNP:rs1042079
- N269 (≠ R281) to T: in dbSNP:rs930337
- VG-L 273:275 (≠ FSVF 285:288) binding
- VFR 297:299 (≠ AHL 310:312) binding
- V322 (= V335) to I: in SORDD; uncertain significance; dbSNP:rs149975952
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1pl6A Human sdh/nadh/inhibitor complex (see paper)
31% identity, 98% coverage: 7:362/365 of query aligns to 2:348/356 of 1pl6A
- active site: C44 (= C49), G45 (≠ A50), S46 (= S51), H49 (≠ K54), H69 (= H78), E70 (= E79), R99 (≠ C111), D102 (≠ C114), C105 (= C117), S113 (≠ C125), F117 (= F131), P156 (= P171), G160 (≠ A175), K344 (= K358)
- binding 4-[2-(hydroxymethyl)pyrimidin-4-yl]-n,n-dimethylpiperazine-1-sulfonamide: C44 (= C49), S46 (= S51), I56 (≠ M61), F59 (≠ P68), H69 (= H78), E155 (= E170), L274 (≠ F288), F297 (≠ H311)
- binding nicotinamide-adenine-dinucleotide: G181 (= G196), P182 (= P197), I183 (≠ L198), D203 (= D218), L204 (= L219), R208 (= R223), C249 (≠ T262), T250 (= T263), V272 (≠ F285), G273 (≠ S286), L274 (≠ F288), F297 (≠ H311), R298 (≠ L312)
- binding zinc ion: C44 (= C49), H69 (= H78)
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
33% identity, 96% coverage: 10:361/365 of query aligns to 2:345/348 of O58389
- C42 (= C49) binding
- T44 (≠ S51) mutation to A: Total loss of enzymatic activity.
- H67 (= H78) binding
- E68 (= E79) binding
- C97 (= C111) binding
- C100 (= C114) binding
- C103 (= C117) binding
- C111 (= C125) binding
- E152 (= E170) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (= L198) binding
- E199 (≠ D218) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (= R223) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ FSV 285:287) binding
- IT 291:292 (≠ VR 307:308) binding
- R294 (≠ A310) mutation to A: 4000-fold decrease in catalytic efficiency.
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
33% identity, 96% coverage: 11:361/365 of query aligns to 1:343/346 of 2dfvA
- active site: C40 (= C49), G41 (≠ A50), T42 (≠ S51), H45 (≠ K54), H65 (= H78), E66 (= E79), C95 (= C111), C98 (= C114), C101 (= C117), C109 (= C125), K113 (≠ N129), P151 (= P171), A155 (= A175), K340 (= K358)
- binding nicotinamide-adenine-dinucleotide: G175 (= G196), P176 (= P197), L177 (= L198), E197 (≠ D218), P198 (≠ L219), R202 (= R223), F241 (≠ T262), S242 (≠ T263), A244 (= A265), L264 (≠ F285), G265 (≠ S286), L266 (≠ V287), I289 (≠ V307), T290 (≠ R308)
- binding zinc ion: C95 (= C111), C101 (= C117), C109 (= C125)
Q5JI69 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see paper)
31% identity, 97% coverage: 11:364/365 of query aligns to 3:348/350 of Q5JI69
- L179 (= L198) binding
- E199 (≠ D218) binding
- R204 (= R223) binding
- LGL 266:268 (≠ FSV 285:287) binding
- IT 291:292 (vs. gap) binding
3gfbA L-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis (see paper)
31% identity, 97% coverage: 11:364/365 of query aligns to 1:346/347 of 3gfbA
- active site: C40 (= C49), G41 (≠ A50), T42 (≠ S51), H45 (≠ K54), H65 (= H78), E66 (= E79), C95 (= C111), C98 (= C114), C101 (= C117), C109 (= C125), K113 (≠ N129), P151 (= P171), A155 (= A175), K340 (= K358)
- binding nicotinamide-adenine-dinucleotide: G173 (= G194), G175 (= G196), P176 (= P197), L177 (= L198), S196 (≠ I217), E197 (≠ D218), P198 (≠ L219), R202 (= R223), F241 (≠ T262), S242 (≠ T263), A244 (= A265), L264 (≠ F285), G265 (≠ S286), L266 (≠ V287), I289 (vs. gap), T290 (vs. gap)
1e3jA Ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly (see paper)
31% identity, 97% coverage: 12:364/365 of query aligns to 2:347/348 of 1e3jA
- active site: C38 (= C49), G39 (≠ A50), S40 (= S51), H43 (≠ K54), H63 (= H78), E64 (= E79), C93 (= C111), C96 (= C114), C99 (= C117), C107 (= C125), T111 (≠ F131), P150 (= P171), G154 (≠ A175), K341 (= K358)
- binding phosphate ion: A174 (= A195), A196 (≠ L219), R197 (≠ V220), S198 (≠ E221), R201 (= R223)
- binding zinc ion: C38 (= C49), H63 (= H78), E64 (= E79), C93 (= C111), C96 (= C114), C99 (= C117), C107 (= C125)
P27867 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Rattus norvegicus (Rat) (see paper)
32% identity, 95% coverage: 15:362/365 of query aligns to 11:349/357 of P27867
P07846 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Ovis aries (Sheep) (see paper)
30% identity, 95% coverage: 15:362/365 of query aligns to 9:346/354 of P07846
- C43 (= C49) binding
- Y49 (≠ F62) binding
- H67 (= H78) binding
- E68 (= E79) binding
- E153 (= E170) binding
- R296 (≠ L312) binding
- Y297 (≠ G313) binding
P07913 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Escherichia coli (strain K12) (see paper)
31% identity, 92% coverage: 26:361/365 of query aligns to 15:338/341 of P07913
- C38 (= C49) mutation to D: Shows only 1% of wild-type catalytic activity. This mutant can be stimulated to the wild-type activity level after incubation with Zn(+).; mutation to S: Loss of catalytic activity. This mutant cannot be stimulated to the wild-type activity level after incubation with Zn(+).
3qe3A Sheep liver sorbitol dehydrogenase (see paper)
30% identity, 95% coverage: 15:362/365 of query aligns to 5:343/351 of 3qe3A
- active site: C39 (= C49), G40 (≠ A50), S41 (= S51), H44 (≠ K54), H64 (= H78), E65 (= E79), R94 (≠ C111), D97 (≠ C114), C100 (= C117), S108 (≠ C125), F112 (= F131), P151 (= P171), G155 (≠ A175), K339 (= K358)
- binding glycerol: Y45 (≠ C55), F54 (= F62), T116 (≠ R135), R293 (≠ L312)
- binding zinc ion: C39 (= C49), H64 (= H78), E65 (= E79)
4ilkA Crystal structure of short chain alcohol dehydrogenase (rspb) from e. Coli cft073 (efi target efi-506413) complexed with cofactor nadh
28% identity, 93% coverage: 11:350/365 of query aligns to 2:322/337 of 4ilkA
- active site: C40 (= C49), G41 (≠ A50), S42 (= S51), H45 (≠ K54), H59 (= H78), E60 (= E79), C89 (= C111), C92 (= C114), C95 (= C117), C103 (= C125), A107 (≠ N129), P145 (= P171), A149 (= A175)
- binding manganese (ii) ion: C40 (= C49), H59 (= H78), E60 (= E79), E144 (= E170)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G168 (= G194), G170 (= G196), P171 (= P197), I172 (≠ L198), D193 (= D218), R194 (≠ L219), R198 (= R223), N213 (≠ D241), A235 (≠ T262), A236 (≠ T263), C237 (≠ G264), I241 (≠ G268), M258 (≠ F285), F260 (= F288)
- binding zinc ion: C89 (= C111), C92 (= C114), C95 (= C117), C103 (= C125)
Sites not aligning to the query:
5vm2A Crystal structure of eck1772, an oxidoreductase/dehydrogenase of unknown specificity involved in membrane biogenesis from escherichia coli
28% identity, 96% coverage: 11:362/365 of query aligns to 2:344/347 of 5vm2A
- active site: C39 (= C49), G40 (≠ A50), S41 (= S51), H44 (= H56), H65 (= H78), E66 (= E79), C95 (= C111), C98 (= C114), C101 (= C117), C109 (= C125), D113 (≠ N129), P153 (= P171), G157 (≠ A175), K340 (= K358)
- binding magnesium ion: H65 (= H78), E66 (= E79), E152 (= E170)
- binding zinc ion: C95 (= C111), C98 (= C114), C101 (= C117), C109 (= C125)
4cpdA Alcohol dehydrogenase tadh from thermus sp. Atn1
29% identity, 96% coverage: 13:361/365 of query aligns to 1:343/346 of 4cpdA
- active site: C38 (= C49), G39 (≠ A50), S40 (= S51), H43 (≠ K54), H59 (= H78), E60 (= E79), C89 (= C111), C92 (= C114), C95 (= C117), C103 (= C125), G107 (≠ N129), D152 (≠ E170), T156 (≠ C174), K340 (= K358)
- binding nicotinamide-adenine-dinucleotide: G39 (≠ A50), S40 (= S51), T156 (≠ C174), G178 (= G196), P179 (= P197), V180 (≠ L198), D200 (= D218), R201 (≠ L219), R205 (= R223), A243 (≠ T262), V244 (≠ T263), V266 (≠ F285), V268 (= V287), L292 (≠ H311), A293 (≠ L312), F333 (≠ A351)
- binding zinc ion: C38 (= C49), H59 (= H78), C89 (= C111), C92 (= C114), C95 (= C117), C103 (= C125), D152 (≠ E170)
4ej6A Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021
28% identity, 97% coverage: 10:363/365 of query aligns to 1:342/343 of 4ej6A
- active site: C40 (= C49), G41 (≠ A50), T42 (≠ S51), H45 (≠ M61), H61 (= H78), E62 (= E79), C91 (= C111), C94 (= C114), C97 (= C117), C105 (= C125), R109 (≠ N129), P147 (= P171), C151 (≠ A175), K337 (= K358)
- binding zinc ion: C91 (= C111), C94 (= C114), C97 (= C117), C105 (= C125)
4ejmA Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to NADP
28% identity, 97% coverage: 10:363/365 of query aligns to 1:342/342 of 4ejmA
- active site: C40 (= C49), G41 (≠ A50), T42 (≠ S51), H45 (≠ M61), H61 (= H78), E62 (= E79), C91 (= C111), C94 (= C114), C97 (= C117), C105 (= C125), R109 (≠ N129), P147 (= P171), C151 (≠ A175), K337 (= K358)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G170 (= G194), G172 (= G196), V173 (≠ P197), I174 (≠ L198), T194 (≠ D218), R195 (≠ L219), Q196 (≠ V220), K199 (≠ R223), C240 (≠ T262), E245 (≠ I267), T246 (≠ G268), L263 (≠ F285), V265 (= V287), I291 (≠ L312)
- binding zinc ion: C91 (= C111), C94 (= C114), C97 (= C117), C105 (= C125)
2ejvA Crystal structure of threonine 3-dehydrogenase complexed with NAD+
30% identity, 92% coverage: 32:365/365 of query aligns to 21:343/343 of 2ejvA
- active site: C38 (= C49), G39 (≠ A50), T40 (≠ S51), H43 (≠ K54), H63 (= H78), E64 (= E79), C93 (= C111), C96 (= C114), C99 (= C117), C107 (= C125), Q111 (≠ N129), P149 (= P171), A153 (= A175), K336 (= K358)
- binding nicotinamide-adenine-dinucleotide: G172 (= G194), G174 (= G196), P175 (= P197), I176 (≠ L198), S195 (≠ I217), D196 (= D218), P197 (≠ L219), R201 (= R223), F238 (≠ T262), S239 (≠ T263), N241 (≠ A265), A244 (≠ G268), L261 (≠ F285), G262 (≠ S286), I263 (≠ V287)
- binding zinc ion: C38 (= C49), H63 (= H78), E64 (= E79), C96 (= C114), C99 (= C117), C107 (= C125)
2dq4A Crystal structure of threonine 3-dehydrogenase
30% identity, 92% coverage: 32:365/365 of query aligns to 21:343/343 of 2dq4A
- active site: C38 (= C49), G39 (≠ A50), T40 (≠ S51), H43 (≠ K54), H63 (= H78), E64 (= E79), C93 (= C111), C96 (= C114), C99 (= C117), C107 (= C125), Q111 (≠ N129), P149 (= P171), A153 (= A175), K336 (= K358)
- binding zinc ion: C38 (= C49), H63 (= H78), E64 (= E79), C93 (= C111), C96 (= C114), C107 (= C125)
Q5SKS4 L-threonine 3-dehydrogenase; TDH; EC 1.1.1.103 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
30% identity, 92% coverage: 32:365/365 of query aligns to 21:343/343 of Q5SKS4
5kiaA Crystal structure of l-threonine 3-dehydrogenase from burkholderia thailandensis
30% identity, 92% coverage: 26:361/365 of query aligns to 14:336/339 of 5kiaA
- active site: C37 (= C49), G38 (≠ A50), T39 (≠ S51), H42 (≠ K54), H61 (= H78), E62 (= E79), C91 (= C111), C94 (= C114), C97 (= C117), C105 (= C125), V109 (≠ N129), P147 (= P171), A151 (= A175), K333 (= K358)
- binding calcium ion: D146 (≠ E170), N150 (≠ C174), E288 (vs. gap)
- binding zinc ion: C91 (= C111), C94 (= C114), C97 (= C117), C105 (= C125)
Query Sequence
>H281DRAFT_04147 FitnessBrowser__Burk376:H281DRAFT_04147
MTNQSTSSDQQNMTAIVCHAPKDYRVEQVAKPRAGAHELVIRIAACGICASDCKCHSGAK
MFWGGPSPWVKAPVIPGHEFFGFVQELGDGAAEHFGVKVGDRVIAEQIVPCAKCRYCKSG
QYWMCEVHNIFGFQREVADGGMAEYMRIPPTAIVHKIPDGISLEDAAIIEPLACAIHTVN
RGELQLDDVVVIAGAGPLGLMMTQVAHLKTPKKLVVIDLVEERLALAREYGADVTINPKT
DDALAIIHSLTDGYGCDVYIETTGAPIGVNQGMDLIRKLGRFVEFSVFGADTTLDWSVIG
DRKELDVRGAHLGPYCYPIAIDLLARGLVTSKGIVTHGFSLEEWDEAIKIANSLDSIKVL
MKPRA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory