Comparing H281DRAFT_04153 FitnessBrowser__Burk376:H281DRAFT_04153 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
53% identity, 98% coverage: 1:485/493 of query aligns to 1:483/484 of P09099
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
51% identity, 98% coverage: 1:485/493 of query aligns to 1:475/476 of 2itmA
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
26% identity, 100% coverage: 3:493/493 of query aligns to 5:483/490 of 3ll3B
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
26% identity, 100% coverage: 3:493/493 of query aligns to 6:485/492 of 3ll3A
3kzbA Crystal structure of xylulokinase from chromobacterium violaceum
30% identity, 84% coverage: 5:417/493 of query aligns to 9:428/498 of 3kzbA
3i8bA The crystal structure of xylulose kinase from bifidobacterium adolescentis
27% identity, 89% coverage: 1:441/493 of query aligns to 5:474/506 of 3i8bA
P18157 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Bacillus subtilis (strain 168) (see paper)
24% identity, 97% coverage: 3:482/493 of query aligns to 6:490/496 of P18157
6udeB Crystal structure of glycerol kinase from elizabethkingia anophelis nuhp1 in complex with adp and glycerol
26% identity, 97% coverage: 1:478/493 of query aligns to 4:482/495 of 6udeB
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
26% identity, 89% coverage: 3:441/493 of query aligns to 8:452/501 of O34154
Sites not aligning to the query:
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
25% identity, 95% coverage: 3:471/493 of query aligns to 2:466/485 of 6k76A
3ge1A 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
23% identity, 93% coverage: 3:460/493 of query aligns to 7:473/499 of 3ge1A
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
23% identity, 93% coverage: 3:460/493 of query aligns to 6:472/498 of Q5HGD2
O86033 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
27% identity, 89% coverage: 3:439/493 of query aligns to 6:447/497 of O86033
1gldG Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
23% identity, 93% coverage: 3:459/493 of query aligns to 4:462/489 of 1gldG
1glcG Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
23% identity, 93% coverage: 3:459/493 of query aligns to 4:462/489 of 1glcG
1glbG Structure of the regulatory complex of escherichia coli iiiglc with glycerol kinase (see paper)
23% identity, 93% coverage: 3:459/493 of query aligns to 4:462/489 of 1glbG
1glfO Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
23% identity, 93% coverage: 3:459/493 of query aligns to 6:471/498 of 1glfO
1bo5O Crystal structure of the complex between escherichia coli glycerol kinase and the allosteric regulator fructose 1,6-bisphosphate. (see paper)
23% identity, 93% coverage: 3:459/493 of query aligns to 6:471/498 of 1bo5O
P0A6F3 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Escherichia coli (strain K12) (see 10 papers)
23% identity, 93% coverage: 3:459/493 of query aligns to 8:473/502 of P0A6F3
Sites not aligning to the query:
1gllO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
23% identity, 93% coverage: 3:459/493 of query aligns to 6:467/494 of 1gllO
>H281DRAFT_04153 FitnessBrowser__Burk376:H281DRAFT_04153
MYLGIDLGTSEVKVLLLASNGRVIGTAGSPFTVSRPHQRWAEQNPEDWWAGTQSALAALR
AKHPDEFAQIRGIGLSGQMHGAVLLDAEDRVLRPAILWNDMRSDKECAELTERAPDLHSV
AGNLAMPGFTAPKLLWVARHEPDIFARTACVLLPKDYLRLQLTGGKVSDPSDAAGTLWLD
VAKRDWSDSLLAACNMTRAQMPSLAEGSAPSGTLLPELAREYGLADGVIVAAGGGDNATS
AIGIGATQPGDGFVSLGTSGVLCVVGDSFRPNPASAVHAFCHAIPDRWHQMSVVLSAASC
LRWVCKLTSTDEPTLLAEIEALPAEALTTAPLFLPYLSGERTPHNDPYAQGVFFGMNHAT
DRALLGYAVLEGVTLALTDGLDALRAAGTEAKALSLLGGGARSDYWAQLLADALDTATRK
HGGGETGAALGAARLGWLAAGGDPATVLSKPPIEKEFTPNPRRHAELRTRLDAYRALYRH
VRPLFDPARERLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory