Comparing H281DRAFT_04156 FitnessBrowser__Burk376:H281DRAFT_04156 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2fdrA Crystal structure of conserved haloacid dehalogenase-like protein of unknown function atu0790 from agrobacterium tumefaciens str. C58
33% identity, 91% coverage: 12:222/233 of query aligns to 5:218/222 of 2fdrA
4eenA Crystal structure of had family hydrolase dr_1622 from deinococcus radiodurans r1 (target efi-501256) with bound magnesium
33% identity, 79% coverage: 11:193/233 of query aligns to 6:192/229 of 4eenA
Q8VZ10 Protein SUPPRESSOR OF QUENCHING 1, chloroplastic; EC 3.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 74% coverage: 11:183/233 of query aligns to 76:255/1055 of Q8VZ10
Sites not aligning to the query:
7ocqB Nadh bound to the dehydrogenase domain of the bifunctional mannitol-1- phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
28% identity, 75% coverage: 13:186/233 of query aligns to 13:187/679 of 7ocqB
Sites not aligning to the query:
7ocrB NADPH and fructose-6-phosphate bound to the dehydrogenase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
28% identity, 75% coverage: 13:186/233 of query aligns to 13:186/675 of 7ocrB
Sites not aligning to the query:
7ocnA Crystal structure of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
28% identity, 75% coverage: 13:186/233 of query aligns to 13:192/690 of 7ocnA
7ocpA NADPH bound to the dehydrogenase domain of the bifunctional mannitol- 1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
28% identity, 75% coverage: 13:186/233 of query aligns to 13:192/688 of 7ocpA
Sites not aligning to the query:
7ocqA Nadh bound to the dehydrogenase domain of the bifunctional mannitol-1- phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
28% identity, 75% coverage: 13:186/233 of query aligns to 13:192/686 of 7ocqA
Sites not aligning to the query:
7ocsA Mannitol-1-phosphate bound to the phosphatase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld-d16a from acinetobacter baumannii (see paper)
34% identity, 41% coverage: 91:186/233 of query aligns to 94:192/682 of 7ocsA
Sites not aligning to the query:
7ocsC Mannitol-1-phosphate bound to the phosphatase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld-d16a from acinetobacter baumannii (see paper)
34% identity, 41% coverage: 91:186/233 of query aligns to 94:192/572 of 7ocsC
Sites not aligning to the query:
1te2A Putative phosphatase ynic from escherichia coli k12
34% identity, 75% coverage: 10:183/233 of query aligns to 4:182/218 of 1te2A
P77247 Hexitol phosphatase B; 2-deoxyglucose-6-phosphate phosphatase; Mannitol-1-phosphatase; Sorbitol-6-phosphatase; Sugar-phosphatase; EC 3.1.3.68; EC 3.1.3.22; EC 3.1.3.50; EC 3.1.3.23 from Escherichia coli (strain K12) (see paper)
34% identity, 75% coverage: 10:183/233 of query aligns to 8:186/222 of P77247
4g9bA Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
44% identity, 31% coverage: 120:192/233 of query aligns to 124:194/227 of 4g9bA
Sites not aligning to the query:
Q94K71 CBBY-like protein; AtCbby; EC 3.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 90% coverage: 11:219/233 of query aligns to 78:301/319 of Q94K71
4uavA Crystal structure of cbby (at3g48420) from arabidobsis thaliana (see paper)
28% identity, 90% coverage: 11:219/233 of query aligns to 5:228/246 of 4uavA
6w04A Crystal structure of had hydrolase, family ia, variant 3 from entamoeba histolytica hm-1:imss
33% identity, 39% coverage: 98:187/233 of query aligns to 96:186/223 of 6w04A
Sites not aligning to the query:
3s6jE The crystal structure of a hydrolase from pseudomonas syringae
24% identity, 87% coverage: 11:213/233 of query aligns to 4:207/220 of 3s6jE
4ex7A Crystal structure of the alnumycin p phosphatase in complex with free phosphate (see paper)
42% identity, 32% coverage: 139:212/233 of query aligns to 136:205/217 of 4ex7A
Sites not aligning to the query:
4ex6A Crystal structure of the alnumycin p phosphatase alnb (see paper)
42% identity, 32% coverage: 139:212/233 of query aligns to 138:207/219 of 4ex6A
Sites not aligning to the query:
5olwA 5-fluorotryptophan labeled beta-phosphoglucomutase in an open conformation (see paper)
24% identity, 76% coverage: 11:187/233 of query aligns to 4:187/224 of 5olwA
>H281DRAFT_04156 FitnessBrowser__Burk376:H281DRAFT_04156
MTAGTSAGNFALICDCDGVLIDSEAVAARMLVHELEARWPGADIEPVVLPLLGLRIEKVL
EGTAMQLGKSLGLDDIDAIRRSVEAAAMQAPAVQGIEQALAQVPLIKGCASNSFRPYVQT
VLARTGLVRFFGDRLFCADSVPNPKPAPDVYLAAAEGLRLAPSACLVVEDSVTGVTAASA
AGMTVLGFIGGGHASDAQIDKLHAAGARHVFDDMHQLPELVAQWTLSATAAAP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory