Comparing H281DRAFT_04270 FitnessBrowser__Burk376:H281DRAFT_04270 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
68% identity, 91% coverage: 27:297/297 of query aligns to 8:278/278 of 2ia4B
2vhaA Debp (see paper)
69% identity, 91% coverage: 27:296/297 of query aligns to 7:276/276 of 2vhaA
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
67% identity, 82% coverage: 27:269/297 of query aligns to 5:247/503 of 8ovoA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
31% identity, 80% coverage: 28:265/297 of query aligns to 6:234/243 of 5eyfB
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
31% identity, 78% coverage: 35:265/297 of query aligns to 4:225/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
31% identity, 78% coverage: 35:265/297 of query aligns to 4:223/225 of 4zv2A
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
28% identity, 80% coverage: 28:265/297 of query aligns to 3:227/229 of 6svfA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
30% identity, 81% coverage: 27:266/297 of query aligns to 2:229/229 of 5t0wA
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
28% identity, 80% coverage: 25:263/297 of query aligns to 1:229/247 of 2yjpA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
26% identity, 78% coverage: 35:266/297 of query aligns to 1:223/224 of 4ymxA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
24% identity, 78% coverage: 35:265/297 of query aligns to 4:226/234 of 3k4uE
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
26% identity, 80% coverage: 26:264/297 of query aligns to 1:229/231 of 2v25A
4z9nB Abc transporter / periplasmic binding protein from brucella ovis with glutathione bound
27% identity, 75% coverage: 21:244/297 of query aligns to 1:224/324 of 4z9nB
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
29% identity, 77% coverage: 37:265/297 of query aligns to 7:224/235 of 2pvuA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
29% identity, 77% coverage: 37:265/297 of query aligns to 3:220/231 of 2q2cA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
29% identity, 77% coverage: 37:265/297 of query aligns to 13:230/241 of 2q2aA
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
26% identity, 88% coverage: 27:286/297 of query aligns to 6:244/251 of 1xt8B
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
25% identity, 89% coverage: 3:266/297 of query aligns to 1:254/260 of P02911
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
25% identity, 77% coverage: 37:266/297 of query aligns to 6:232/238 of 1lstA
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
25% identity, 77% coverage: 37:266/297 of query aligns to 6:232/238 of 1lahE
>H281DRAFT_04270 FitnessBrowser__Burk376:H281DRAFT_04270
MKVKKAALLLATLGLFTVGAHAQDAGTLKKIKDTGVISLGHRESSIPFSYYDDKQNVIGY
SQEFALKVVDAVKQKLNMPNLKVKLTPVTSQNRIPLVQNGTVDMECGSTTNNAERQQQVA
FSNTIFVIGTRLMTKKDSGIKDWADLKGKTVVTTAGTTSERLLRKMNQDKSMGMNIISAK
DHGESFLTLSTGRAAAFMMDDALLAGERAKSNTPNDFVIVGAPQSHEAYGCMLRKNDPEF
KKVVDDAIAKVETSGEADQIYKKWFETPIPPKGLNLNFPESDDIKALFKSPNDKAID
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory