SitesBLAST
Comparing H281DRAFT_04285 FitnessBrowser__Burk376:H281DRAFT_04285 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
P13804 Electron transfer flavoprotein subunit alpha, mitochondrial; Alpha-ETF from Homo sapiens (Human) (see 6 papers)
60% identity, 98% coverage: 6:313/314 of query aligns to 22:330/333 of P13804
- G116 (= G98) to R: in GA2A; impaired protein stability and loss of electron transfer activity; dbSNP:rs119458971
- T171 (= T153) to I: decreased protein stability; dbSNP:rs1801591
- R223 (= R205) binding
- S248 (= S231) binding
- R249 (= R232) mutation to A: Loss of electron transfer activity.
- VGQT 263:266 (= VGQT 246:249) binding
- T266 (= T249) to M: in GA2A; decreased electron transfer activity; dbSNP:rs119458970
- SGAIQH 281:286 (= SGAIQH 264:269) binding
- N300 (= N283) binding
- DL 318:319 (= DL 301:302) binding
Sites not aligning to the query:
- 20:204 Domain I
- 205:333 Domain II
2a1uA Crystal structure of the human etf e165betaa mutant (see paper)
60% identity, 98% coverage: 6:313/314 of query aligns to 4:312/315 of 2a1uA
- binding flavin-adenine dinucleotide: G204 (= G204), R205 (= R205), S230 (= S231), R231 (= R232), A232 (= A233), Q244 (= Q245), V245 (= V246), G246 (= G247), T248 (= T249), G261 (= G262), I262 (= I263), S263 (= S264), A265 (= A266), Q267 (= Q268), H268 (= H269), N282 (= N283), K283 (= K284), D300 (= D301), L301 (= L302)
1efpA Electron transfer flavoprotein (etf) from paracoccus denitrificans (see paper)
64% identity, 89% coverage: 33:313/314 of query aligns to 29:307/307 of 1efpA
- binding flavin-adenine dinucleotide: G199 (= G204), R200 (= R205), G201 (= G206), S225 (= S231), R226 (= R232), A227 (= A233), Q239 (= Q245), V240 (= V246), G241 (= G247), T243 (= T249), G256 (= G262), I257 (= I263), S258 (= S264), A260 (= A266), Q262 (= Q268), H263 (= H269), N277 (= N283), K278 (= K284), D295 (= D301), L296 (= L302)
6fahE Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
38% identity, 91% coverage: 28:313/314 of query aligns to 94:388/393 of 6fahE
- binding flavin-adenine dinucleotide: L180 (≠ Q113), R200 (= R128), M281 (≠ R205), G282 (= G206), R307 (= R232), A308 (= A233), Q320 (= Q245), V321 (= V246), G322 (= G247), Q323 (= Q248), T324 (= T249), G337 (= G262), I338 (= I263), S339 (= S264), Q343 (= Q268), H344 (= H269), N358 (= N283), K359 (= K284), L377 (= L302)
Sites not aligning to the query:
- binding iron/sulfur cluster: 7, 10, 13, 17, 18, 35, 36, 37, 38, 41, 45, 49
5ow0A Crystal structure of an electron transfer flavoprotein from geobacter metallireducens (see paper)
40% identity, 79% coverage: 65:313/314 of query aligns to 45:291/292 of 5ow0A
- binding flavin-adenine dinucleotide: G183 (= G204), R184 (= R205), G185 (= G206), S209 (= S231), R210 (= R232), Q223 (= Q245), I224 (≠ V246), G225 (= G247), T227 (= T249), G240 (= G262), V241 (≠ I263), S242 (= S264), A244 (= A266), Q246 (= Q268), H247 (= H269), N261 (= N283), K262 (= K284), D279 (= D301), Y280 (≠ L302)
5ol2A The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
35% identity, 98% coverage: 7:313/314 of query aligns to 5:324/331 of 5ol2A
- binding calcium ion: E75 (= E74), D188 (vs. gap)
- binding flavin-adenine dinucleotide: T117 (≠ I114), R136 (= R128), I147 (≠ V139), G216 (= G204), R217 (= R205), G218 (= G206), S242 (= S231), R243 (= R232), A244 (= A233), Q256 (= Q245), V257 (= V246), G258 (= G247), T260 (= T249), G273 (= G262), I274 (= I263), S275 (= S264), A277 (= A266), Q279 (= Q268), H280 (= H269), N294 (= N283), K295 (= K284), D312 (= D301), V313 (≠ L302)
4kpuA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
38% identity, 72% coverage: 88:313/314 of query aligns to 100:332/338 of 4kpuA
- binding flavin-adenine dinucleotide: L125 (≠ Q113), R144 (= R128), I155 (≠ V139), G224 (= G204), R225 (= R205), G226 (= G206), S250 (= S231), R251 (= R232), A252 (= A233), Q264 (= Q245), V265 (= V246), G266 (= G247), Q267 (= Q248), S268 (≠ T249), G281 (= G262), I282 (= I263), S283 (= S264), S285 (≠ A266), Q287 (= Q268), H288 (= H269), N302 (= N283), K303 (= K284), D320 (= D301), A321 (≠ L302)
7qh2A Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
32% identity, 97% coverage: 8:311/314 of query aligns to 15:329/337 of 7qh2A
- binding flavin-adenine dinucleotide: L125 (≠ Q113), T126 (≠ I114), R144 (= R128), I155 (≠ V139), R224 (= R205), G225 (= G206), T249 (≠ S231), R250 (= R232), Q263 (= Q245), I264 (≠ V246), G265 (= G247), L266 (≠ Q248), S267 (≠ T249), G280 (= G262), I281 (= I263), S282 (= S264), Q286 (= Q268), N301 (= N283), S302 (≠ K284), D303 (= D285), D319 (= D301), L320 (= L302)
7koeB Electron bifurcating flavoprotein fix/etfabcx (see paper)
34% identity, 98% coverage: 7:313/314 of query aligns to 8:327/336 of 7koeB
- binding flavin-adenine dinucleotide: T121 (≠ I114), R140 (= R128), T142 (≠ I130), G219 (= G204), K220 (≠ R205), G221 (= G206), S245 (= S231), R246 (= R232), A247 (= A233), Q259 (= Q245), V260 (= V246), G261 (= G247), Q262 (= Q248), T263 (= T249), G276 (= G262), S278 (= S264), Q282 (= Q268), H283 (= H269), N297 (= N283), I298 (≠ K284), L316 (= L302)
P53571 Electron transfer flavoprotein subunit alpha; Alpha-ETF; Electron transfer flavoprotein large subunit; ETFLS from Methylophilus methylotrophus (Bacterium W3A1) (see 2 papers)
35% identity, 98% coverage: 7:313/314 of query aligns to 5:319/321 of P53571
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3clrD Crystal structure of the r236a etf mutant from m. Methylotrophus (see paper)
34% identity, 98% coverage: 7:313/314 of query aligns to 4:318/319 of 3clrD
- binding flavin-adenine dinucleotide: G209 (= G204), R210 (= R205), G211 (= G206), S235 (= S231), A236 (≠ R232), P237 (≠ A233), Q249 (= Q245), V250 (= V246), G251 (= G247), Q252 (= Q248), S253 (≠ T249), G267 (= G262), I268 (= I263), S269 (= S264), S271 (≠ A266), Q273 (= Q268), H274 (= H269), N288 (= N283), T289 (≠ K284), D306 (= D301), I307 (≠ L302)
Query Sequence
>H281DRAFT_04285 FitnessBrowser__Burk376:H281DRAFT_04285
MTNLVNLVIAEHDNTSIKGATLNTIAAAQKVGGDIHVLVAGQNAQAAADAAAKLAGVSKV
LLADAPQLAEGLAENVEATVLNIAKDYSHIFAPATAYGKNIAPRIAAKLDVAQISDITAV
DSPDTFERPIYAGNAIATVQSADPIKVITVRTTGFDAVAAEGGNATVEKIEAAADAGISQ
FVSREVTKLDRPELTSAKIIVSGGRGLGNGENYTKVLEPLADKLNAALGASRAAVDAGFV
PNDYQVGQTGKIVAPQLYVAVGISGAIQHLAGMKDSKVIVAINKDPEAPIFSVADYGLVG
DLFTLVPELVSELG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory