SitesBLAST
Comparing H281DRAFT_04287 FitnessBrowser__Burk376:H281DRAFT_04287 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
25% identity, 71% coverage: 108:420/438 of query aligns to 62:375/377 of Q5L2C2
- V180 (≠ P223) binding
- R309 (= R355) binding
- 334:340 (vs. 379:385, 29% identical) binding
- R336 (≠ T381) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
25% identity, 95% coverage: 1:417/438 of query aligns to 26:402/824 of Q8GAI3
- W66 (= W55) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (≠ A56) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
23% identity, 95% coverage: 3:416/438 of query aligns to 4:362/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (≠ L6), G8 (= G7), G10 (= G9), V11 (= V10), I12 (≠ V11), V30 (≠ I29), E31 (≠ D30), K32 (≠ R31), E38 (= E38), A39 (≠ T39), S40 (= S40), A43 (≠ N43), G45 (= G45), L46 (≠ Q46), V171 (≠ I224), G200 (≠ L253), G201 (= G254), W203 (≠ Y256), G298 (= G353), R300 (= R355), P301 (= P356), Y326 (≠ G380), R327 (≠ T381), N328 (≠ L382), G329 (= G383), I330 (≠ W384)
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
24% identity, 71% coverage: 108:417/438 of query aligns to 61:370/370 of 4yshA
- active site: I262 (≠ V310), L283 (= L331), G305 (= G353), N335 (≠ L382), L338 (≠ T385)
- binding flavin-adenine dinucleotide: V178 (≠ P223), S206 (≠ L253), G207 (= G254), W209 (≠ Y256), R307 (= R355), H332 (= H379), R334 (≠ T381), N335 (≠ L382), G336 (= G383), I337 (≠ W384)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
24% identity, 70% coverage: 108:415/438 of query aligns to 61:368/368 of 4yshB
- active site: I262 (≠ V310), L283 (= L331), G305 (= G353), N335 (≠ L382), L338 (≠ T385)
- binding flavin-adenine dinucleotide: V178 (≠ P223), S206 (≠ L253), W209 (≠ Y256), R307 (= R355), H332 (= H379), R334 (≠ T381), N335 (≠ L382), G336 (= G383), I337 (≠ W384), L338 (≠ T385)
- binding glycine: G249 (≠ Y297), Y251 (≠ I299), Y251 (≠ I299), A264 (≠ G312), R307 (= R355), R334 (≠ T381), R334 (≠ T381)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48
6pxsA Crystal structure of iminodiacetate oxidase (idaa) from chelativorans sp. Bnc1 (see paper)
25% identity, 95% coverage: 1:415/438 of query aligns to 1:363/370 of 6pxsA
- binding flavin-adenine dinucleotide: G7 (= G7), G9 (= G9), I10 (≠ V10), D30 (= D30), N32 (≠ E32), H33 (≠ A33), K36 (≠ E38), A37 (≠ T39), T38 (≠ S40), A40 (= A42), G41 (≠ N43), A42 (= A44), G43 (= G45), V44 (≠ Q46), Y174 (≠ I224), A203 (≠ L253), W206 (≠ Y256), I210 (≠ F260), Y250 (= Y297), G305 (= G353), R307 (= R355), G333 (= G380), A334 (≠ T381), S335 (≠ L382), G336 (= G383), L337 (≠ W384), T338 (= T385)
6j39A Crystal structure of cmis2 with inhibitor (see paper)
27% identity, 74% coverage: 92:415/438 of query aligns to 44:368/368 of 6j39A
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: M44 (= M92), P46 (≠ Q94), N49 (≠ T97), R243 (≠ A287), Y252 (≠ I299), Y267 (≠ A314), R308 (= R355), R334 (≠ T381), I335 (≠ L382)
- binding flavin-adenine dinucleotide: M44 (= M92), A174 (= A228), A203 (≠ L253), W206 (≠ Y256), I228 (≠ S276), Y252 (≠ I299), R308 (= R355), S333 (≠ G380), R334 (≠ T381), I335 (≠ L382), G336 (= G383), V337 (≠ W384), Q338 (≠ T385)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 9, 10, 11, 29, 30, 31, 32, 36, 37, 38, 40, 41, 42, 43
6j38A Crystal structure of cmis2 (see paper)
27% identity, 74% coverage: 92:415/438 of query aligns to 44:368/368 of 6j38A
- binding flavin-adenine dinucleotide: M44 (= M92), A174 (= A228), A203 (≠ L253), W206 (≠ Y256), G226 (= G274), G306 (= G353), R308 (= R355), S333 (≠ G380), R334 (≠ T381), I335 (≠ L382), G336 (= G383), V337 (≠ W384), Q338 (≠ T385)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 9, 11, 29, 30, 31, 36, 37, 38, 41, 42, 43
2gagB Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
23% identity, 48% coverage: 207:415/438 of query aligns to 178:387/403 of 2gagB
- binding flavin-adenine dinucleotide: V195 (≠ I224), G224 (= G254), A225 (≠ S255), H227 (≠ S257), L231 (= L261), L246 (≠ I277), G352 (= G380), T353 (= T381), G354 (≠ L382), G355 (= G383), F356 (≠ W384), K357 (≠ T385)
- binding flavin mononucleotide: V250 (= V282), E278 (≠ G312), R321 (≠ S349), W323 (= W351)
- binding 2-furoic acid: M263 (≠ E295), Y270 (≠ F304), K357 (≠ T385)
- binding sulfite ion: K276 (≠ V310)
Sites not aligning to the query:
- active site: 61, 64, 65
- binding flavin-adenine dinucleotide: 26, 28, 29, 30, 51, 52, 58, 59, 60, 62, 63, 64, 66
- binding flavin mononucleotide: 61, 62, 171
- binding 2-furoic acid: 64, 66, 68, 401
- binding sulfite ion: 170
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
22% identity, 65% coverage: 120:402/438 of query aligns to 78:350/369 of O31616
- V174 (≠ I224) binding
- H244 (≠ Y297) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (= R355) binding
- 327:333 (vs. 379:385, 29% identical) binding
- R329 (≠ T381) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
3ad8B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with pyrrole 2-carboxylate (see paper)
24% identity, 45% coverage: 207:403/438 of query aligns to 179:376/404 of 3ad8B
- active site: G326 (= G353), K358 (≠ T385)
- binding flavin-adenine dinucleotide: V196 (≠ I224), G225 (= G254), A226 (≠ S255), H228 (≠ S257), L247 (≠ I277), G353 (= G380), T354 (= T381), G355 (≠ L382), G356 (= G383), F357 (≠ W384), K358 (≠ T385)
- binding flavin mononucleotide: V251 (= V282), E279 (≠ G312), R322 (≠ S349), W324 (= W351)
- binding pyrrole-2-carboxylate: M264 (≠ E295), Y271 (≠ F304), T354 (= T381), K358 (≠ T385)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63, 172
- binding pyrrole-2-carboxylate: 65, 67, 69, 402
3ad7B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
24% identity, 45% coverage: 207:403/438 of query aligns to 179:376/404 of 3ad7B
- active site: G326 (= G353), K358 (≠ T385)
- binding flavin-adenine dinucleotide: V196 (≠ I224), G225 (= G254), A226 (≠ S255), H228 (≠ S257), L247 (≠ I277), G353 (= G380), T354 (= T381), G355 (≠ L382), G356 (= G383), F357 (≠ W384), K358 (≠ T385)
- binding flavin mononucleotide: V251 (= V282), K277 (≠ V310), E279 (≠ G312), R322 (≠ S349), W324 (= W351)
- binding [methylthio]acetate: M264 (≠ E295), Y271 (≠ F304), T354 (= T381), K358 (≠ T385)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63, 172
- binding [methylthio]acetate: 67, 69, 402
1vrqB Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
24% identity, 45% coverage: 207:403/438 of query aligns to 179:376/402 of 1vrqB
- active site: G326 (= G353), K358 (≠ T385)
- binding n,n-dimethylglycine: K358 (≠ T385)
- binding flavin-adenine dinucleotide: V196 (≠ I224), A224 (= A252), G225 (= G254), H228 (≠ S257), L247 (≠ I277), G353 (= G380), T354 (= T381), G355 (≠ L382), G356 (= G383), F357 (≠ W384), K358 (≠ T385)
- binding flavin mononucleotide: V251 (= V282), E279 (≠ G312), R322 (≠ S349), W324 (= W351)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding n,n-dimethylglycine: 65, 67, 69, 401
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 51, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63, 172
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
22% identity, 65% coverage: 120:402/438 of query aligns to 78:350/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (≠ I299), R302 (= R355), R329 (≠ T381)
- binding flavin-adenine dinucleotide: V174 (≠ I224), S202 (≠ L253), G203 (= G254), W205 (≠ Y256), F209 (= F260), G300 (= G353), R302 (= R355), H327 (= H379), R329 (≠ T381), N330 (≠ L382), G331 (= G383), I332 (≠ W384)
- binding phosphate ion: R89 (≠ E131), R254 (= R307)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49
Q50LF2 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 4 papers)
24% identity, 45% coverage: 207:403/438 of query aligns to 180:377/405 of Q50LF2
- V197 (≠ I224) binding
- H270 (≠ A300) mutation to A: 10-fold decrease in catalytic efficiency.
- Y272 (≠ F304) mutation to A: 13000-fold decrease in catalytic efficiency.; mutation to F: 130-fold decrease in catalytic efficiency.
- G354 (= G380) binding
- G357 (= G383) binding
- K359 (≠ T385) binding ; mutation K->A,D: Loss of activity.; mutation to R: Retains 0.07% of wild-type activity. Shows higher apparent KM for sarcosine.
Sites not aligning to the query:
- 31 binding
- 32 binding
- 53 binding
- 61 binding
- 62 binding
- 66 binding
- 68 binding
- 172 K→A: Retains 39% of wild-type activity.; K→D: Retains 32% of wild-type activity.; K→R: Retains 58% of wild-type activity.
- 173 modified: Tele-8alpha-FMN histidine
P40875 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 3 papers)
23% identity, 48% coverage: 207:415/438 of query aligns to 180:389/405 of P40875
- C195 (≠ T222) mutation to S: No change in activity.
- C351 (≠ T377) mutation to A: No change in activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 30 G→A: Prevents covalent attachment of FMN. Blocks subunit assembly.
- 146 C→S: No change in activity.
- 173 modified: Tele-8alpha-FMN histidine; H→N: Prevents covalent attachment of FMN. Loss of activity. The mutant is considerably less stable than wild-type enzyme, the beta and delta subunits are lost during purification, which yields a stable alpha-gamma complex.
- 175 H→A: No effect on FMN binding and activity.
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
22% identity, 65% coverage: 120:402/438 of query aligns to 78:350/364 of 3if9A
- binding flavin-adenine dinucleotide: P173 (= P223), V174 (≠ I224), S202 (≠ L253), G203 (= G254), W205 (≠ Y256), F209 (= F260), G300 (= G353), R302 (= R355), H327 (= H379), F328 (≠ G380), R329 (≠ T381), N330 (≠ L382), G331 (= G383), I332 (≠ W384)
- binding glycolic acid: Y246 (≠ I299), R302 (= R355), R329 (≠ T381)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
20% identity, 72% coverage: 100:415/438 of query aligns to 51:368/374 of 1y56B
- active site: H224 (≠ G274), P239 (= P288), G305 (= G353), M338 (≠ T385)
- binding flavin-adenine dinucleotide: E170 (≠ P223), V171 (≠ I224), T200 (≠ L253), N201 (≠ G254), W203 (≠ Y256), G305 (= G353), Y306 (≠ L354), Y307 (≠ R355), G334 (≠ T381), H335 (≠ L382), G336 (= G383), F337 (≠ W384), M338 (≠ T385)
- binding flavin mononucleotide: I260 (≠ R309), R301 (≠ S349), W303 (= W351)
Sites not aligning to the query:
- active site: 44, 47, 48
- binding flavin-adenine dinucleotide: 11, 13, 14, 15, 33, 34, 35, 42, 43, 45, 46, 47, 49
- binding flavin mononucleotide: 44, 45
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
26% identity, 40% coverage: 108:281/438 of query aligns to 59:230/827 of 3gsiA
Sites not aligning to the query:
- active site: 256, 549
- binding flavin-adenine dinucleotide: 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49, 256, 330, 331, 332, 357, 358, 359, 360
- binding magnesium ion: 254, 409
- binding (6s)-5,6,7,8-tetrahydrofolate: 505, 536, 551, 563, 629, 648, 655, 696
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
26% identity, 40% coverage: 108:281/438 of query aligns to 60:231/828 of 1pj6A
Sites not aligning to the query:
- active site: 257, 550
- binding flavin-adenine dinucleotide: 9, 11, 12, 13, 33, 34, 42, 43, 44, 46, 48, 50, 257, 331, 332, 358, 359, 360, 361
Query Sequence
>H281DRAFT_04287 FitnessBrowser__Burk376:H281DRAFT_04287
MRVVVLGSGVVGVTSAYYLARAGHEVTVIDREAGPALETSFANAGQISPGYASPWAAPGV
PLKAVKWMFQKHAPLAIRLDGTQFQLQWMWQMLQNCTESRYAVNKGRMVRLAEYSRDCLQ
ALRAETGIQYEGRTGGTLQVFRTQQQFDGAAKDIAVLREANVPYELLSAAELAQAEPALA
AVSHKLTGGLRLPGDETGDCQMFTTRLAALAEQLGVKFRYNTPIDALAMAGDRIAGVQCG
NELVRADSFVVALGSYSTKFLSGLVKIPVYPLKGYSITAPIVNEAAAPVSTVLDETYKIA
ITRFDNRIRVGGMAEIVGFDKSLRQARRETLELCVNDLFPGGGDTSKASFWTGLRPMTPD
GTPIVGRTPVANLFLNTGHGTLGWTMSCGSGQLLADVISGKQPAIKADDLSVHRYLGDTG
SAHRPAYARSVTSRTREI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory