Comparing H281DRAFT_04459 FitnessBrowser__Burk376:H281DRAFT_04459 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
31% identity, 48% coverage: 30:354/682 of query aligns to 3:302/309 of Q53W83
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
31% identity, 48% coverage: 30:353/682 of query aligns to 3:301/301 of 1v1aA
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
32% identity, 46% coverage: 30:341/682 of query aligns to 3:292/300 of 1v1bA
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
26% identity, 48% coverage: 31:355/682 of query aligns to 3:307/308 of 2dcnA
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
26% identity, 48% coverage: 30:357/682 of query aligns to 2:311/311 of 2varA
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
25% identity, 48% coverage: 30:358/682 of query aligns to 3:313/313 of Q97U29
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
25% identity, 44% coverage: 56:354/682 of query aligns to 22:306/306 of 5eynA
Sites not aligning to the query:
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
28% identity, 41% coverage: 31:312/682 of query aligns to 3:255/304 of 3ih0A
Sites not aligning to the query:
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
28% identity, 41% coverage: 31:312/682 of query aligns to 2:254/302 of 3gbuA
Sites not aligning to the query:
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
25% identity, 44% coverage: 56:354/682 of query aligns to 26:310/310 of 5yggA
Sites not aligning to the query:
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
27% identity, 45% coverage: 30:334/682 of query aligns to 3:289/312 of 3in1A
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
27% identity, 44% coverage: 51:353/682 of query aligns to 20:307/319 of Q8ZKR2
Sites not aligning to the query:
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
27% identity, 44% coverage: 51:353/682 of query aligns to 16:296/299 of 1tz3A
Sites not aligning to the query:
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
27% identity, 44% coverage: 51:353/682 of query aligns to 16:296/297 of 1tz6A
Sites not aligning to the query:
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
22% identity, 48% coverage: 31:354/682 of query aligns to 4:306/308 of 3iq0B
3lkiB Crystal structure of fructokinase with bound atp from xylella fastidiosa
24% identity, 48% coverage: 29:355/682 of query aligns to 3:319/322 of 3lkiB
P55264 Adenosine kinase; AK; Adenosine 5'-phosphotransferase; EC 2.7.1.20 from Mus musculus (Mouse) (see paper)
29% identity, 18% coverage: 221:344/682 of query aligns to 226:358/361 of P55264
Sites not aligning to the query:
5kb5A Crystal structure of the adenosine kinase from mus musculus in complex with adenosine and adenosine-diphosphate
29% identity, 18% coverage: 221:344/682 of query aligns to 207:339/341 of 5kb5A
Sites not aligning to the query:
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
25% identity, 41% coverage: 31:311/682 of query aligns to 8:263/312 of 4wjmA
Sites not aligning to the query:
1bx4A Structure of human adenosine kinase at 1.50 angstroms (see paper)
26% identity, 18% coverage: 221:344/682 of query aligns to 207:339/342 of 1bx4A
Sites not aligning to the query:
>H281DRAFT_04459 FitnessBrowser__Burk376:H281DRAFT_04459
MAQSSTFSGTPAQQPGGAAGSRFAPGRSRDIVCLGRLAVDLYAQQVGARLEDVSSFAKYL
GGSSANIAFGCARLGLASAMLARVGNDHMGRFLTETLTKEGCDVSHVRVDPERLTALVLL
GLKDRDTFPLIFYRENCADMAVDEADFDEAFIASSKALLITGTHFSTEQVNRTSRRALDY
ARRNQVRTVLDIDYRPVLWGLTGKADGETRFVASEGVTAHLQRILPLFDLVIGTEEEFRI
AGGKSDLLDALAMVRAVTPATLVLKRGPMGCQIIDGEVPASLDDTPVHGGVEVEVLNVLG
AGDAFASGFLSGWLRDQPLDACARAANASGALVVSRHACAPAMPTPAELDYFLREAKADP
ERMRRPDRDATLARLHRVTPARKQWDEVLGFAFDHRNQFFELAQQSGASEARIAQLKGLF
VDAVAQTESALGLQGRIGVLIDSRYGQDALNAATGRGWWIGRPVELPGSVPLVFDHGRSV
GTTLVSWPQEHVAKCLVQFHPDEPVEQRLEQEAQLRALYDATQASGHELLLEVIPPKHAN
LPQGPDIVYRALKRLYNIGIYPEWWKLEPMDAAQWRNIDALIAERDPYCRGVVLLGLSAG
VEQLNEGFRAAARSSTCRGFTVGRTIFHEPSHAWLAGEIGDDELIARVRRTFETLIASWR
AARDTAAAERGASNRVHQEQAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory