Comparing H281DRAFT_04460 FitnessBrowser__Burk376:H281DRAFT_04460 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
32% identity, 87% coverage: 21:263/279 of query aligns to 2:239/501 of P04983
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 82% coverage: 23:252/279 of query aligns to 1:223/240 of 4ymuJ
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
30% identity, 88% coverage: 19:263/279 of query aligns to 7:246/265 of P07821
3d31A Modbc from methanosarcina acetivorans (see paper)
32% identity, 82% coverage: 23:252/279 of query aligns to 1:215/348 of 3d31A
Sites not aligning to the query:
1g291 Malk (see paper)
31% identity, 84% coverage: 26:259/279 of query aligns to 6:229/372 of 1g291
Sites not aligning to the query:
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
27% identity, 80% coverage: 20:242/279 of query aligns to 3:216/240 of 1ji0A
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
29% identity, 80% coverage: 22:244/279 of query aligns to 5:208/353 of 1vciA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
28% identity, 79% coverage: 23:242/279 of query aligns to 2:213/241 of 4u00A
5x40A Structure of a cbio dimer bound with amppcp (see paper)
34% identity, 84% coverage: 23:256/279 of query aligns to 4:231/280 of 5x40A
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
27% identity, 86% coverage: 24:263/279 of query aligns to 7:241/375 of 2d62A
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
31% identity, 81% coverage: 23:249/279 of query aligns to 4:222/285 of 4yerA
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
30% identity, 83% coverage: 11:242/279 of query aligns to 1:229/257 of P0AAH0
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
25% identity, 90% coverage: 23:273/279 of query aligns to 4:254/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 73% coverage: 23:225/279 of query aligns to 4:210/253 of 1g9xB
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
28% identity, 91% coverage: 22:276/279 of query aligns to 2:249/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
28% identity, 91% coverage: 22:276/279 of query aligns to 2:249/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
28% identity, 91% coverage: 22:276/279 of query aligns to 2:249/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
28% identity, 91% coverage: 22:276/279 of query aligns to 2:249/353 of Q97UY8
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 79% coverage: 23:242/279 of query aligns to 17:225/378 of P69874
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
25% identity, 78% coverage: 23:241/279 of query aligns to 3:214/242 of 3c4jA
>H281DRAFT_04460 FitnessBrowser__Burk376:H281DRAFT_04460
MSDTNSVTNEMSLTSAAPQDDVILALENVNKYFGKVIALSGVTLRLKRGEVHCLLGDNGA
GKSTLIKTLAGVHQPSSGQYLVDGKPVLFESPKDALDLGIATVYQDLALVPLLSVARNFF
MGREPQRKLFGFLNVMDLETSATTARDKLAEMGINVRDPHQPIGTMSGGEKQCLAIARAI
HFGARVLILDEPTAALGVKQSFNVLKLIHKARAKGISVIFITHNVHHAYPIGDSFTLLNR
GKSLGTFTKETISKDEVLDMMAGGAEMQKMIGELEGATI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory