Comparing H281DRAFT_04462 FitnessBrowser__Burk376:H281DRAFT_04462 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
4ru1A Crystal structure of carbohydrate transporter acei_1806 from acidothermus cellulolyticus 11b, target efi-510965, in complex with myo-inositol
32% identity, 88% coverage: 38:344/348 of query aligns to 9:283/288 of 4ru1A
6guqA Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with glucose
28% identity, 72% coverage: 35:284/348 of query aligns to 3:252/278 of 6guqA
6gt9A Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with galactose
28% identity, 72% coverage: 35:284/348 of query aligns to 8:257/283 of 6gt9A
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
26% identity, 85% coverage: 48:342/348 of query aligns to 14:294/313 of 2h3hA
Sites not aligning to the query:
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
25% identity, 85% coverage: 48:342/348 of query aligns to 14:294/305 of 3c6qC
Sites not aligning to the query:
5xssA Xylfii molecule (see paper)
23% identity, 72% coverage: 35:283/348 of query aligns to 5:253/274 of 5xssA
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
25% identity, 67% coverage: 48:280/348 of query aligns to 14:245/274 of 2ioyA
Sites not aligning to the query:
5dkvA Crystal structure of an abc transporter solute binding protein from agrobacterium vitis(avis_5339, target efi-511225) bound with alpha-d- tagatopyranose
20% identity, 74% coverage: 45:300/348 of query aligns to 17:300/303 of 5dkvA
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
24% identity, 62% coverage: 77:291/348 of query aligns to 45:264/290 of 4wutA
Sites not aligning to the query:
4rxmB Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
23% identity, 54% coverage: 84:272/348 of query aligns to 51:243/288 of 4rxmB
Sites not aligning to the query:
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
23% identity, 62% coverage: 65:280/348 of query aligns to 36:245/270 of 4zjpA
Sites not aligning to the query:
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
22% identity, 67% coverage: 48:280/348 of query aligns to 19:255/289 of 5hqjA
Sites not aligning to the query:
4rxmA Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
23% identity, 54% coverage: 84:272/348 of query aligns to 53:245/291 of 4rxmA
Sites not aligning to the query:
3ksmA Crystal structure of abc-type sugar transport system, periplasmic component from hahella chejuensis
21% identity, 70% coverage: 37:280/348 of query aligns to 3:251/276 of 3ksmA
>H281DRAFT_04462 FitnessBrowser__Burk376:H281DRAFT_04462
MRLCKGKATLRILVTALTLATGFGAASAARAADAHFVLISHAPDSDSWWNTIKNAIKQAD
EDFNVETDYRNPPNGDIADMARLVEQAAARNYDGVIVTIADYDVLKSSINKVTAKKIPLV
TINSGTEEQSAQLGAIMHIGQPEYVAGKAAGEKAKAAGVKSFLCVNHLATNTVSFDRCRG
FAEALGVDYKSSTIDSGQDPTEIQSKVSAYLRNHPNTGAILTLGPTPASATLKAVQQMGL
NGKIYFCTFDFSDDIAKAIQNGTIQFAIDQQPYLQGYIPVAVLAIVKKEHTTDPAKIRQI
LEANPKFKARLATYGLAPSYGPKNIRSGPGFITKENLDKVIKYAGQYR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory